Recombinant Dog Gap junction alpha-1 protein (GJA1)

Shipped with Ice Packs
In Stock

Description

Diagnostic Assays

The Dog GJA1 ELISA Kit (Assay Genie) detects endogenous GJA1 in serum, plasma, and cell cultures with high sensitivity (intra-assay CV < 10%) . This kit is pivotal for:

  • Quantifying GJA1 dysregulation in cardiac arrhythmias .

  • Monitoring gap junction integrity in cancer models .

Functional Studies

Recombinant GJA1 enables:

  • Trafficking Studies: Investigating cytoskeletal interactions (e.g., actin/microtubule dynamics) using truncated isoforms like GJA1-20k .

  • Mitochondrial Research: GJA1-20k overexpression enhances mitochondrial biogenesis and reduces ROS production, mimicking ischemic preconditioning .

Disease Relevance

  • Cardioprotection: GJA1-20k upregulation during ischemia reduces infarct size by 39% in murine models, highlighting therapeutic potential .

  • Cancer Metastasis: GJA1 loss correlates with disrupted cell communication in canine osteosarcoma .

Future Directions

Recombinant Dog GJA1 is a cornerstone for advancing canine-specific therapies, particularly in cardiology and oncology. Ongoing research aims to:

  • Engineer heat-stable variants for field diagnostics.

  • Explore gene therapy using AAV9 vectors to deliver GJA1-20k in heart disease models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
GJA1; Gap junction alpha-1 protein; Connexin-43; Cx43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-382
Protein Length
Full Length of Mature Protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
GGWSALAKLLGKVQAYSPAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGA NVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKREPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GQSDPYHATTGPLSPSKDCGSPEYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Uniprot No.

Target Background

Function
Gap junction alpha-1 protein (GJA1) is a gap junction protein that acts as a regulator of bladder capacity. A gap junction is composed of a cluster of closely packed pairs of transmembrane channels, known as connexons, through which low molecular weight materials can diffuse from one cell to an adjacent cell. GJA1 may play a crucial role in auditory physiology by participating in potassium recycling to the cochlear endolymph. It serves as a negative regulator of bladder functional capacity, enhancing intercellular electrical and chemical transmission, thereby sensitizing bladder muscles to cholinergic neural stimuli and triggering contraction. GJA1 may also play a role in cell growth inhibition by regulating the expression and localization of NOV. It plays an essential role in gap junction communication within the ventricles.
Database Links

STRING: 9615.ENSCAFP00000041768

UniGene: Cfa.119

Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.

Q&A

What functional domains of recombinant dog GJA1 are critical for experimental applications?

Several functional domains are critical when working with recombinant dog GJA1:

DomainPositionFunctionResearch Significance
N-terminal domainAA 2-12Channel gatingExists in three conformations: gate-covering (GCN), pore-lining (PLN), and flexible intermediate (FIN)
First transmembrane helixTM1Pore formationUndergoes α-to-π-helix transition creating side membrane openings in FIN and PLN conformations
Extracellular loopsE1 & E2Connexon dockingCritical for gap junction formation between adjacent cells
Tubulin-binding domainAA 234-243Cytoskeletal interactionUnique to GJA1 and not conserved in other connexin families
C-terminal tailAA 255-382Regulatory interactionsContains phosphorylation sites and protein interaction regions

The C-terminal region (AA 255-382) is particularly important as NMR studies show it has a random coil structure with two short α-helices, allowing for numerous interactions with different proteins while forming higher-order structures . The region AA 234-243 contains a putative tubulin-binding sequence that is unique to GJA1 and not conserved in other gap junction protein families .

What expression systems yield optimal functional recombinant dog GJA1 and what are their comparative advantages?

Different expression systems for recombinant dog GJA1 offer varying advantages:

Expression SystemAdvantagesLimitationsYieldApplications
E. coliHigh yield, cost-effective, simple culture conditionsLimited post-translational modifications, potential for inclusion bodies>90% purity reportedStructural studies, antibody production, protein-protein interaction assays
Mammalian cellsNative-like post-translational modifications, proper foldingLower yield, higher cost, more complexVariableFunctional assays, trafficking studies, channel activity assessment
Insect cellsBetter protein folding than E. coli, moderate costGlycosylation patterns differ from mammalsModerateStructural studies requiring some post-translational modifications

For E. coli expression, protocols typically include:

  • Expression with N-terminal His-tag for purification

  • Lyophilization for storage

  • Reconstitution in appropriate buffer systems (Tris/PBS-based buffer, pH 8.0)

  • Addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

Researchers should consider the experimental application when selecting an expression system. For studies focusing on channel formation and cell-cell communication, mammalian expression systems may be preferable despite lower yields .

How can post-translational modifications of dog GJA1 be accurately characterized and their functional significance assessed?

Characterizing post-translational modifications (PTMs) of dog GJA1 requires multiple complementary approaches:

  • Phosphorylation analysis techniques:

    • Western blotting with phospho-specific antibodies (e.g., anti-phospho-Connexin 43/GJA1 (S368))

    • Lambda phosphatase treatment to confirm phosphospecificity

    • Mass spectrometry for comprehensive phosphorylation site mapping

  • Functional assessment of phosphorylation:

    • Site-directed mutagenesis of phosphorylation sites

    • Comparison of wild-type and phospho-mutant proteins in trafficking assays

    • Gap junction plaque formation analysis using immunofluorescence

    • Dye transfer assays to assess channel permeability

  • Ubiquitination analysis:

    • Immunoprecipitation combined with ubiquitin-specific antibodies

    • Mass spectrometry to identify ubiquitination sites

    • Proteasome inhibitor treatments to assess degradation pathways

Research has shown that phosphorylation at S368 by Protein Kinase C delta causes movement of Connexin 43 within gap junctions, followed by vesicle internalization and protein degradation. This can be visualized using immunofluorescence microscopy and quantified through western blot analysis .

How can recombinant dog GJA1 be used to study the novel GJA1-20k isoform and its role in actin organization?

GJA1-20k, an N-terminus truncated isoform of Connexin 43, has emerged as a critical regulator of actin organization and mitochondrial protection. Research methodologies include:

  • Direct binding assays:

    • Cell-free TIRF (Total Internal Reflection Fluorescence) imaging of purified GJA1-20k with actin

    • Co-sedimentation assays to quantify binding affinity

    • FRET (Förster Resonance Energy Transfer) analysis to measure interaction dynamics

  • Structural analysis:

    • 3D reconstruction of "mitochondrial actin cages" formed by GJA1-20k

    • High-resolution confocal microscopy of GJA1-20k and actin organization around mitochondria

  • Functional studies:

    • Ischemia-reperfusion models to assess GJA1-20k's protective effects

    • Live-cell imaging of mitochondrial dynamics under stress conditions

    • Assessment of mitochondrial swelling in the presence/absence of GJA1-20k

Cell-free TIRF imaging has established that GJA1-20k directly binds to actin, forming both actin clusters and stabilized actin filaments. This binding results in a rich collection of actin around mitochondria, forming dense actin sheets ("mitochondrial actin cages") that appear to limit mitochondrial swelling under stress conditions .

What methodologies are most effective for studying GJA1's role in cilia formation and function?

To investigate GJA1's role in cilia formation and function, researchers can employ these approaches:

  • Loss-of-function studies:

    • siRNA-mediated depletion of GJA1 in human RPE1 cells

    • CRISPR/Cas9-mediated mutagenesis targeting GJA1

    • Dominant-negative mutants (T154A point mutation, Δ130–136 deletion, Δ234–243 deletion)

  • Visualization techniques:

    • Immunofluorescence analysis using acetylated tubulin antibody to detect ciliary axonemes

    • Co-immunostaining of GJA1 with trans-Golgi marker TGN46 or pericentriolar material marker BBS4

    • Live imaging of cilia formation and dynamics

  • Quantitative measurements:

    • Counting acetylated tubulin-positive cells to quantify ciliated cells

    • Measuring the length of isolated cilia

    • Analyzing basal body formation and localization

  • Molecular interaction studies:

    • Immunoprecipitation with anti-GJA1 antibody-conjugated paramagnetic beads

    • Mass spectrometry to identify GJA1-interacting proteins

    • Validation of interactions through co-immunoprecipitation and co-localization studies

Research has shown that GJA1 depletion significantly disrupts cilia formation in RPE1 cells, with GJA1 accumulating in pericentriolar regions where the primary cilium originates. This suggests GJA1 plays a role in primary cilium formation by affecting trafficking around pericentriolar regions involved in cilia formation .

How can cryo-electron microscopy be optimized for structural analysis of recombinant dog GJA1 gap junction channels?

Optimizing cryo-electron microscopy (cryo-EM) for structural analysis of recombinant dog GJA1 gap junction channels involves multiple technical considerations:

  • Sample preparation:

    • Expression of full-length recombinant dog GJA1 with minimal tags

    • Reconstitution in lipid nanodiscs to mimic native membrane environment

    • Testing various detergents including cholesteryl hemisuccinates which shift conformational equilibrium to gate-covering (GCN) state

  • Data collection parameters:

    • Voltage: Typically 300 kV for high-resolution data

    • Defocus range: -1.0 to -3.0 μm to enhance contrast

    • Dose: Minimizing beam damage while maintaining signal-to-noise ratio

    • Tilt series: For tomographic reconstruction of gap junction plaques

  • Conformational state analysis:

    • Identification of N-terminal helix conformations (GCN, PLN, FIN)

    • Analysis of conformation distribution in different conditions

    • Assessment of α-to-π-helix transitions in the first transmembrane helix

  • Validation approaches:

    • Comparison with alternative structural methods (X-ray crystallography, NMR)

    • Mutagenesis of key residues identified in structural analysis

    • Functional correlation using dye transfer or electrophysiological methods

Recent cryo-EM studies have revealed that recombinant GJA1 exists in a dynamic equilibrium state with various channel conformations, including three different N-terminal helix conformations that are randomly distributed in purified gap junction intercellular channel particles. The conformational equilibrium can be shifted by factors such as cholesteryl hemisuccinates, C-terminal truncations, and pH changes .

What are the most common challenges in producing functional recombinant dog GJA1 and how can they be addressed?

Researchers face several challenges when producing functional recombinant dog GJA1:

ChallengeCauseSolutionEvidence-based Approach
Protein aggregationHydrophobic transmembrane domainsAdd stabilizing agents (e.g., 6% Trehalose); Use membrane-mimetic environmentsReported successful use of Tris/PBS-based buffer with 6% Trehalose at pH 8.0
Low yieldToxicity to expression hostUse tightly regulated inducible promoters; Optimize induction conditionsSuccessful expression in E. coli with >90% purity as determined by SDS-PAGE
Improper foldingComplex transmembrane topologyExpression at lower temperatures (16-20°C); Use specialized E. coli strains (e.g., Origami)NMR studies show proper folding is critical for functional domains
DegradationProtease sensitivityAdd protease inhibitors; Optimize purification speedRepeated freeze-thaw cycles should be avoided; Store working aliquots at 4°C for up to one week
Loss of functionImproper reconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL; Add 5-50% glycerol for long-term storageReconstitution protocols validated through functional assays

For optimal results, researchers should monitor protein quality at each step using techniques such as circular dichroism to assess secondary structure, size-exclusion chromatography to detect aggregation, and functional assays to confirm channel-forming ability .

How can researchers resolve contradictory data regarding GJA1 localization and trafficking in different experimental systems?

Resolving contradictory data regarding GJA1 localization and trafficking requires systematic analysis:

  • Standardize detection methods:

    • Use validated antibodies specific to different domains of GJA1

    • Compare multiple antibodies targeting different epitopes

    • Employ epitope-tagged recombinant GJA1 for consistent detection

    • Validate specificity through knockdown/knockout controls

  • Account for cellular context differences:

    • Document cell type-specific variations in GJA1 localization

    • Analyze the expression of trafficking machinery components

    • Consider cell density and junction formation status

    • Evaluate the influence of cell polarization status

  • Reconcile contradictory findings:

    • In epithelial cells: GJA1 shows dual localization at gap junctions and in pericentriolar regions

    • In cardiac cells: GJA1-20k contributes to trafficking by arranging actin to guide full-length Cx43 delivery

    • During epithelial-mesenchymal transition: Altered translation initiation of GJA1 limits gap junction formation

  • Methodological considerations:

    • Live imaging versus fixed cell analysis

    • Overexpression artifacts versus endogenous protein

    • 2D versus 3D culture systems

    • Time-course analyses to capture dynamic localization changes

Research has shown that GJA1 localization varies significantly between cell types. In RPE1 cells, GJA1 localizes to gap junctions at cell periphery and accumulates in pericentriolar regions, while in Xenopus epithelial tissues, it shows ciliary localization. These differences highlight the importance of cellular context in GJA1 trafficking and function .

What are the essential controls and validation steps needed when studying dominant-negative mutations of dog GJA1?

When studying dominant-negative mutations of dog GJA1, comprehensive controls and validation steps are crucial:

  • Mutation design and validation:

    • Sequence verification of all constructs

    • Protein expression confirmation by western blot

    • Half-life assessment to rule out stability differences

    • In vitro Cas9 reaction testing for CRISPR-based approaches

  • Functional validation:

    • Gap junction formation assessment by immunofluorescence

    • Channel permeability using dye transfer assays (e.g., Lucifer yellow)

    • Electrical coupling measurements in cell pairs

    • Comparison with known dominant-negative mutants (T154A, Δ130–136)

  • Rescue experiments:

    • Co-transfection with siRNA-non-targetable wild-type GJA1

    • Dose-dependent rescue to establish dominant-negative effect

    • Phenotype quantification before and after rescue

  • Mechanistic analysis:

    • Determine if mutation affects assembly, trafficking, or channel function

    • Assess interaction with wild-type protein through co-immunoprecipitation

    • Analyze subcellular localization changes

    • Evaluate effects on interacting partners

Research on three dominant-negative mutants (T154A point mutation, Δ130–136 deletion mutation, and Δ234–243 deletion mutation) has shown that each causes severe defects in cilia formation. Immunofluorescence analysis revealed shortened and fewer ciliary axonemes in mutant-expressing embryos, with the number of ciliated cells significantly reduced compared to controls. Importantly, the Δ234–243 mutant, which affects the tubulin-binding sequence unique to GJA1, showed the most pronounced effect on cilia number .

How can recombinant dog GJA1 be used to investigate its role in mitochondrial protection during cardiac stress?

Recent research has revealed GJA1's unexpected role in mitochondrial protection during cardiac stress, particularly through its truncated isoform GJA1-20k. Investigation approaches include:

  • Mitochondrial function assessment:

    • Measure mitochondrial membrane potential using fluorescent indicators

    • Assess mitochondrial respiration with Seahorse XF analysis

    • Evaluate ROS production during simulated ischemia-reperfusion

    • Analyze mitochondrial calcium handling under stress conditions

  • Actin cage formation analysis:

    • High-resolution confocal microscopy to visualize actin organization around mitochondria

    • 3D reconstruction of actin cages

    • Live-cell imaging to track actin dynamics during stress responses

    • Correlative light and electron microscopy for ultrastructural analysis

  • Therapeutic potential assessment:

    • Delivery of recombinant GJA1-20k in cardiac injury models

    • Evaluation of cell-cell coupling maintenance during acute ischemia

    • Measurement of infarct size reduction in GJA1-20k-treated hearts

    • Assessment of long-term cardiac function after ischemic injury

Research has demonstrated that GJA1-20k directly binds to actin, forming stabilized actin filaments that create "mitochondrial actin cages." These structures appear to prevent pathological mitochondrial swelling during oxidative stress, potentially explaining GJA1-20k's protective effects against ischemia-reperfusion injury .

What novel approaches can be used to study GJA1's role in epithelial-mesenchymal transition (EMT)?

Studying GJA1's role in epithelial-mesenchymal transition requires innovative approaches:

  • Translation regulation analysis:

    • Assessment of internal translation initiation producing truncated GJA1 isoforms

    • Analysis of PI3K/Akt/mTOR pathway activation during EMT

    • Polysome profiling to determine translational efficiency of GJA1 mRNA

    • Use of translation inhibitors to modulate GJA1 isoform production

  • Protein stability and turnover:

    • Pulse-chase experiments to measure GJA1 half-life during EMT

    • Ubiquitination analysis through immunoprecipitation

    • Proteasome and lysosome inhibitor treatments

    • Live-cell imaging of fluorescently tagged GJA1 during EMT

  • Functional consequences:

    • Gap junction communication assessment using dye transfer

    • Electrical coupling measurements during EMT progression

    • Correlation of GJA1 isoform expression with invasion and migration

    • Restoration of gap junction function through targeted approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.