Recombinant Dog Gap junction alpha-5 protein (GJA5)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression System

  • Host: E. coli (BL21 or similar strains) .

  • Tag: N-terminal His-tag for affinity chromatography purification .

Biological Roles

  • Cardiac Conduction: Critical for synchronized atrial cardiomyocyte depolarization; mutations linked to atrial fibrillation in humans and model organisms .

  • Vascular Regulation: Expressed in pulmonary artery smooth muscle cells (PASMCs); modulates hyperoxia-induced lung injury responses .

  • Developmental Biology: Regulatory mutations upstream of GJA5 alter transcription, affecting feather pigmentation in chickens .

Research Applications

Experimental Uses

  • SDS-PAGE Analysis: Primary application for purity verification .

  • Antibody Development: Basis for generating custom antibodies targeting connexin-40 .

  • Structural Studies: Used to map connexin interactions and channel gating mechanisms .

Comparative Studies

  • Cross-Species Homology: Dog GJA5 shares >85% sequence identity with human (P36382) and mouse (Q5T3B6) isoforms .

  • Functional Conservation: Retains ion channel activity comparable to human Cx40 in electrophysiological assays .

Limitations and Challenges

  • Solubility Issues: Requires optimized buffers (e.g., glycerol or trehalose) to prevent aggregation .

  • Functional Assays: Limited data on dog-specific in vivo activity; most functional insights extrapolated from human/mouse studies .

Future Directions

  • Cardiac Disease Models: Testing dog GJA5 in atrial fibrillation studies to bridge translational gaps .

  • Structural Biology: Cryo-EM studies to resolve full-length connexin-40 architecture .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
GJA5; Gap junction alpha-5 protein; Connexin-40; Cx40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-358
Protein Length
Full Length of Mature Protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
GJA5
Target Protein Sequence
GDWSFLGEFLEEVHKHSTVIGKVWLTVLFIFRMLVLGTAAESSWGDEQADFQCDTMQPGC GNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEARGAG SYEYPVAEKAELSCWEEVNGRIVLQGTLLNTYVCSILIRTTMEVAFIVGQYLLYGIFLDT LHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLFLSLAELYHLGWKKLRQRFVKS GQGMAECQLPGPSAGIVQNCTPPPDFNQCLENGPGGKFFNPFSNKMASQQNTDNLATEQV QGQEPIPGEGFIHIRYAQKPEVPNGASPGHRLPHGYQSDKRRLSKASSKARSDDLSV
Uniprot No.

Target Background

Function
Gap junctions are composed of clusters of closely packed connexon transmembrane channels. These channels facilitate the diffusion of low-molecular-weight materials between adjacent cells.
Gene References Into Functions
  1. Increased myocardial fibrosis correlates positively with upregulated myocardial Cx40 protein expression in the left atrium of rapidly paced canine hearts. PMID: 21426757
  2. An altered transmural Cx40/43 gradient contributes to the vulnerability of a sterile pericarditis model to atrial arrhythmia induction and maintenance. PMID: 17434983
  3. Three heterozygous base changes (C384G, C402T, C837T) identified in screened dogs were determined to be synonymous mutations. However, these mutations have also been found in unrelated healthy dogs. PMID: 17939028
  4. During atrial fibrillation, the myocardial sleeve tissue's calpain system is activated and may hydrolyze Cx40 protein. PMID: 18577882
  5. This study reports changes in connexin expression and the atrial fibrillation substrate in congestive heart failure. PMID: 19875729
Database Links
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What experimental approaches validate recombinant GJA5 functionality in canine models?

Validating recombinant GJA5 functionality requires multi-layered assays to assess structural integrity, localization, and intercellular communication. Key methods include:

Functional Assays

  • Lucifer yellow dye transfer: Quantify gap junction-mediated communication by measuring dye diffusion between transfected cells .

  • Immunofluorescence staining: Use anti-Cx40/GJA5 antibodies (e.g., ab183648) to confirm proper localization at cell-cell junctions .

  • Western blotting: Verify protein expression levels and post-translational modifications (e.g., phosphorylation) using SDS-PAGE and specific antibodies .

Comparative Studies

ParameterWild-Type GJA5Mutant GJA5 (e.g., p.Pro265Ser)
Gap junction plaquesDense, visibleSparse or absent
Dye transfer rateHigh (control)Reduced (>50% decrease)
Zebrafish heart morphologyNormal (6%)Abnormal (37%)

How do structural variations in GJA5 affect gap junction assembly?

Mutations in GJA5’s carboxyl-terminus (e.g., p.Pro265Ser) disrupt critical interactions required for connexon assembly. Key mechanisms include:

Molecular Impacts

  • Altered protein folding: Mutations may impair proper membrane integration or oligomerization into hexamers .

  • Reduced cell adhesion: Disrupted C-terminal interactions hinder gap junction plaque formation at cell-cell interfaces .

  • Compromised channel gating: Mutations could block voltage-dependent opening of connexons .

Experimental Models

  • Zebrafish microinjection: Assess developmental phenotypes (e.g., heart tube morphology) by comparing wild-type and mutant GJA5 .

  • Mammalian cell systems: Use HEK293 cells to compare gap junction function via electrophysiological recordings or calcium imaging .

What challenges arise in expressing recombinant GJA5 in heterologous systems?

Recombinant GJA5 production faces technical hurdles due to its membrane-bound nature and post-translational requirements.

Common Challenges

  • Proper glycosylation: HEK293 cells may not replicate native canine glycosylation patterns, affecting protein stability or function .

  • Oligomerization efficiency: Insufficient hexamer formation reduces functional gap junction assembly .

  • Purification yield: Detergent solubilization and affinity chromatography (e.g., His/Fc/Avi tags) must balance purity and activity .

Optimization Strategies

ChallengeSolution
Low expressionCo-express with chaperones (e.g., calnexin)
MisfoldingUse low-temperature expression systems
Membrane extractionScreen detergents (e.g., DDM vs. Triton X-100)

How do you design experiments to study GJA5’s role in canine cardiovascular diseases?

GJA5 is implicated in congenital heart defects (e.g., tetralogy of Fallot). Experimental workflows should integrate genetic, cellular, and in vivo approaches:

Experimental Design

  • Genetic screening: Use TaqMan assays to detect GJA5 variants (e.g., c.793C>T) in canine populations .

  • Functional validation:

    • Cellular models: Compare dye transfer or calcium waves in canine fibroblasts with wild-type vs. mutant GJA5 .

    • Tissue engineering: Incorporate recombinant GJA5 into cardiac organoids to study intercellular signaling .

  • In vivo models: Use CRISPR-edited dogs or induced pluripotent stem cells (iPSCs) to mimic human-like GJA5 mutations .

What statistical methods assess GJA5 mutation significance in canine populations?

Analyzing GJA5 mutations requires robust statistical frameworks to account for population structure:

Statistical Approaches

MethodApplicationExample Use Case
Fisher’s exact testCompare mutation frequencies in cases vs. controlsDetect enrichment of GJA5 variants in TOF cohorts
PHATE embeddingIdentify behavioral or genetic clustersMap breed-specific GJA5-associated traits
GWAS meta-analysisIntegrate multi-breed datasetsPrioritize GJA5 as a susceptibility locus for CHD

How do species-specific differences in GJA5 impact cross-species studies?

Canine GJA5 shares ~85% homology with human GJA5 , but structural and functional differences necessitate cautious extrapolation:

Key Considerations

  • Phylogenetic conservation: Align GJA5 sequences across species to identify critical residues (e.g., Pro265) .

  • Functional divergence: Validate dog-specific GJA5 interactions using co-immunoprecipitation or proximity ligation assays.

  • Expression patterns: Compare GJA5 localization in canine vs. human cardiac tissues using immunohistochemistry .

What methodologies resolve discrepancies in GJA5’s role across studies?

Conflicting findings often stem from differences in experimental models or technical biases.

Troubleshooting Strategies

  • Control for expression levels: Normalize GJA5 expression via qPCR or Western blot before functional assays .

  • Account for isoforms: Use isoform-specific antibodies (e.g., anti-Cx40) to avoid cross-reactivity .

  • Validate assay specificity: Include negative controls (e.g., siRNA knockdown) to confirm GJA5 dependency .

How can recombinant GJA5 be used to study axon guidance in canine neurodevelopment?

GJA5 interacts with neurodevelopmental pathways, particularly in herding breeds . Experimental approaches include:

Mechanistic Insights

  • Co-culture assays: Examine GJA5-mediated communication between neurons and glial cells.

  • CRISPRi/a screens: Identify GJA5 regulators (e.g., axon guidance genes) in iPSC-derived neurons.

  • Single-cell RNA-seq: Map GJA5 expression across neurodevelopmental cell states .

What computational tools predict GJA5’s structural impact of missense mutations?

In silico tools help prioritize mutations for functional studies:

Predictive Models

ToolApplication
SIFT/PolyPhen-2Predict deleteriousness of missense variants
Phyre2Model tertiary structure disruptions
MUMPSIdentify critical residues for channel gating

How do you integrate GJA5 with multi-omics data to study breed-specific traits?

Integrating GJA5 with genomic, transcriptomic, and epigenomic data reveals functional networks:

Analytical Workflow

  • GWAS + eQTL mapping: Link GJA5 variants to expression levels in cardiac or neural tissues .

  • Protein interaction networks: Use STRING or BioGRID to identify GJA5 partners (e.g., connexins, cytoskeletal proteins) .

  • Pathway enrichment analysis: Identify neurodevelopmental or cardiac pathways enriched with GJA5-associated genes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.