Recombinant Dog Gastrin/cholecystokinin type B receptor (CCKBR)

Shipped with Ice Packs
In Stock

Description

Molecular Overview of CCKBR

CCKBR, encoded by the CCKBR gene (NCBI Gene ID: 485333 in dogs), features:

  • Structure: 453-amino acid protein with seven transmembrane domains .

  • Function:

    • Binds gastrin (EC₅₀ ~0.1 nM) and CCK with high affinity .

    • Activates phosphatidylinositol-calcium signaling via Gαq/11 proteins .

  • Tissue Distribution: Predominantly in gastric parietal cells and cerebral cortex .

PropertyDetail
SynonymsCCK-BR, CCK2-R, Gastrin receptor
UniProt IDP30552 (Dog)
Molecular Weight48.5 kDa
Subcellular LocalizationCell membrane (multi-pass transmembrane)

Receptor Cloning and Validation

  • Expression Strategy: Isolated from canine parietal cell cDNA libraries using radioligand-binding assays .

  • Binding Specificity:

    • Agonists: Sulfated/non-sulfated CCK-8, gastrin-17 .

    • Antagonists: L-364,718 (IC₅₀ = 19 nM) and L-365,260 (IC₅₀ = 130 nM) .

  • Signaling: Triggers phospholipase C-mediated Ca²⁺ mobilization .

Pharmacological Distinction

  • Unlike guinea pig brain CCK-B receptors, canine recombinant CCKBR shows reversed antagonist potency (L-364,718 > L-365,260), resolving interspecies variation .

Applications in Research

Recombinant dog CCKBR is utilized in:

  • Drug Development: Screening gastrin/CCK antagonists for gastrointestinal disorders .

  • Mechanistic Studies:

    • Role in gastric acid hypersecretion .

    • Neuromodulation of anxiety and pain perception .

  • Diagnostic Tools: Quantified via ELISA (detection limit: ~0.1 ng/mL) .

ELISA Workflow (Assay Genie Kit CNEB0198) :

StepActionIncubation
1Coat wells with 100 µL sample120 min, 37°C
2Add Detection Reagent A60 min, 37°C
3Wash (3×), add Detection Reagent B60 min, 37°C
4Develop with TMB substrate, stop with H₂SO₄10–20 min, 37°C (light-protected)

Sample Preparation Guidelines :

Sample TypeProtocol
Serum/PlasmaCentrifuge at 1,000×g; store at -80°C
Tissue HomogenatesLyse in RIPA buffer, centrifuge at 14,000×g

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary by purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. Please specify your required tag type for preferential development.
Synonyms
CCKBR; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MELLKLNRSAQGSGAGPGASLCRAGGALLNSSGAGNLSCEPPRLRGAGTRELELAIRVTL YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVVCKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIIATWM LSGLLMVPYPVYTAVQPAGGARALQCVHRWPSARVRQTWSVLLLLLLFFVPGVVMAVAYG LISRELYLGLRFDEDSDSESRVRSQGGLRGGAGPGPAPPNGSCRPEGGLAGEDGDGCYVQ LPRSRQTLELSALTAPTPGPGGGPRPYQAKLLAKKRVVRMLLVIVVLFFLCWLPLYSANT WRAFDSSGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPR ARPRPLPDEDPPTPSIASLSRLSYTTISTLGPG
Uniprot No.

Target Background

Function
The recombinant dog Gastrin/cholecystokinin type B receptor (CCKBR) is a receptor for gastrin and cholecystokinin. CCK-B receptors are widely distributed throughout the central nervous system, where they modulate various functions including anxiety, analgesia, arousal, and neuroleptic activity. This receptor exerts its effects through G protein coupling, activating a phosphatidylinositol-calcium second messenger system.
Database Links

KEGG: cfa:485333

UniGene: Cfa.23476

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Parietal cells, pancreas, brain and various neoplastic tissues.

Q&A

What is the molecular structure of canine gastrin/CCKBR?

Nucleotide sequence analysis has revealed that the canine gastrin receptor consists of an open reading frame encoding a 453-amino acid protein. The receptor contains seven putative hydrophobic transmembrane domains, which is characteristic of G protein-coupled receptors (GPCRs). Furthermore, the canine CCKBR shows significant homology with members of the beta-adrenergic family of G protein-coupled receptors, positioning it within this larger receptor superfamily . The seven-transmembrane domain architecture is crucial for the receptor's ability to bind ligands and transduce signals across the plasma membrane, initiating intracellular signaling cascades that mediate physiological responses to gastrin and cholecystokinin.

How does canine gastrin/CCKBR relate to CCK-B receptors in the brain?

The relationship between gastrin receptors in parietal cells and CCK-B receptors in the brain has been a subject of significant research interest. High-stringency RNA blot analysis has identified gastrin receptor transcripts in both parietal cells and cerebral cortex . This finding, combined with the observation that the pharmacological properties of the parietal cell gastrin receptor closely resemble those of the predominant CCK receptor in the brain (CCK-B), suggests that these receptors are either highly homologous or potentially identical . This molecular similarity has important implications for understanding the evolutionary conservation of these signaling systems across different tissues and may explain the pleiotropic effects of gastrin and CCK peptides in different physiological systems.

What signaling pathways are activated by the canine gastrin/CCKBR?

The canine gastrin/CCKBR primarily signals through the phospholipase C pathway. Studies with the expressed recombinant receptor in COS-7 cells have demonstrated gastrin-stimulated phosphatidylinositol hydrolysis . Additionally, gastrin stimulation leads to intracellular Ca²⁺ mobilization in cells expressing the cloned receptor . These observations suggest that the primary second messenger systems activated by CCKBR are phospholipase C-mediated phosphatidylinositol turnover and subsequent calcium signaling. These pathways are consistent with the receptor's physiological roles in regulating gastric acid secretion and potentially modulating neuronal plasticity through calcium-dependent mechanisms.

What techniques are most effective for cloning and expressing recombinant dog gastrin/CCKBR?

Successful cloning of the canine gastrin receptor has been achieved using a parietal cell cDNA expression library screened with a radioligand-binding strategy . This approach involves creating a cDNA library from tissue expressing the receptor of interest, followed by expression in a suitable host system and screening for binding of radiolabeled ligands. The methodology includes:

  • Isolation of mRNA from canine parietal cells

  • Creation of a cDNA expression library

  • Transfection of the library into mammalian expression systems (e.g., COS-7 cells)

  • Screening for positive clones using radioligand binding assays

  • Isolation and sequencing of candidate clones

For expression studies, mammalian cell systems like COS-7 cells have proven effective for producing functional recombinant receptor that demonstrates appropriate binding specificity for gastrin/CCK agonists and antagonists . This expression system allows the receptor to undergo proper folding and potential post-translational modifications necessary for ligand binding and signaling functions.

How can researchers verify the functional activity of recombinant dog gastrin/CCKBR?

Verification of functional activity for recombinant dog gastrin/CCKBR requires multiple complementary approaches:

  • Binding assays: Demonstrating specific binding of gastrin/CCK agonists and antagonists with pharmacological properties matching those of the native receptor. The expressed recombinant receptor should show the same binding specificity for gastrin/CCK agonists and antagonists as the canine parietal cell receptor .

  • Signaling assays: Measuring downstream signaling events such as gastrin-stimulated phosphatidylinositol hydrolysis and intracellular Ca²⁺ mobilization in cells expressing the cloned receptor .

  • Affinity labeling: Performing affinity labeling of the expressed receptor in host cells to verify that it produces a protein identical in size to the native parietal cell receptor .

These functional validation approaches collectively provide robust evidence for the proper expression and activity of the recombinant receptor, ensuring that it faithfully recapitulates the properties of the native receptor.

What molecular techniques can distinguish between CCKBR and related receptors?

Distinguishing CCKBR from related receptors, particularly CCKAR, requires specialized molecular approaches:

  • High-stringency hybridization: RNA blot analysis under high-stringency conditions can be used to identify receptor transcripts in different tissues, as demonstrated in studies examining gastrin receptor expression in parietal cells and cerebral cortex .

  • Selective pharmacology: Using receptor subtype-selective ligands to differentiate binding to CCKBR versus CCKAR. The binding profile of compounds to the recombinant receptor can be compared with known profiles of selective compounds.

  • Site-directed mutagenesis: Creating targeted mutations in regions that differ between receptor subtypes to identify amino acid residues critical for subtype-selective ligand binding.

  • Viral vector-based approaches: As demonstrated in neurobiological studies, viral vectors can be used to target and manipulate specific receptor-expressing populations. For example, AAV(retro)-EF1a-DO-mCherry-DIO-EGFP viruses have been used to identify and characterize CCK-positive neuronal projections .

These molecular techniques provide complementary approaches to distinguish CCKBR from related receptors, essential for understanding their distinct physiological roles.

How can CCKBR be utilized in neuroplasticity and learning studies?

CCKBR has emerged as an important target for studies of neuroplasticity and learning, with several experimental approaches demonstrating its significance:

  • Genetic knockout models: Cck knockout mice (Cck −/−) show impaired motor skill learning in tasks such as the single pellet reaching task and defects in long-term potentiation (LTP) induction in the motor cortex . These models provide valuable insights into the role of CCK signaling in learning processes.

  • Pharmacological manipulation: Direct infusion of CCKBR antagonists (e.g., L365.260) into specific brain regions like the motor cortex can block receptor function and impair motor learning . This approach allows for temporal and spatial control of receptor modulation.

  • Calcium imaging: Implementing miniscope imaging over the motor cortex enables researchers to monitor neuronal activity patterns during motor tasks and observe how these patterns are refined with learning. Studies have shown that in Cck −/− mice or those treated with CCKBR antagonists, the refinement of neuronal activity patterns during motor learning is impaired .

  • Chemogenetic approaches: Using DREADDs (Designer Receptors Exclusively Activated by Designer Drugs) to specifically inhibit CCK-positive neuronal projections from the rhinal cortex to the motor cortex has demonstrated that these projections are crucial for motor skill learning .

  • Rescue experiments: Administration of CCKBR agonists such as CCK4 (Trp-Met-Asp-Phe-NH2) can rescue defective motor learning in Cck −/− mice, providing compelling evidence for CCKBR's role in learning processes .

These methodological approaches collectively demonstrate that CCKBR signaling plays a critical role in modulating neuroplasticity during learning, opening new avenues for investigating learning mechanisms.

What structural approaches reveal CCKBR-ligand interactions?

Understanding the structural basis of CCKBR-ligand interactions requires sophisticated structural biology approaches:

  • Cryo-electron microscopy (Cryo-EM): This technique has successfully revealed the structures of human CCKBR in complex with gastrin-17 and different G proteins (Gi2 and Gq) . These structures provide detailed molecular insights into ligand binding modes and receptor activation mechanisms.

  • X-ray crystallography: Crystal structures of related receptors (such as CCKAR) in complex with different ligands, including peptide agonists and small-molecule antagonists, have revealed recognition patterns of different ligand types and the molecular basis of peptide selectivity in the cholecystokinin receptor family .

  • Structure-function studies: Combining structural data with functional assays to correlate structural features with specific receptor functions provides a comprehensive understanding of receptor activation mechanisms.

The structural information obtained through these approaches is invaluable for understanding receptor activation mechanisms and can guide the development of more selective ligands for research and potential therapeutic applications.

What methods can identify specific neuronal populations expressing CCKBR?

Identifying and characterizing specific neuronal populations expressing CCKBR requires specialized neuroanatomical techniques:

  • Retrograde viral tracing: Injection of retrograde viral tracers (e.g., AAV(retro)-EF1a-DO-mCherry-DIO-EGFP) into target regions such as the motor cortex can label neurons projecting to these regions. Studies have shown that nearly 99% of neurons projecting from the rhinal cortex to the motor cortex are CCK-positive .

  • Cre-dependent labeling: In transgenic models such as Cck-Cre mice, Cre-dependent fluorescent reporters can be used to visualize CCK-expressing neurons. When combined with retrograde tracing, this approach can identify specific CCK-positive projections .

  • Immunohistochemistry: Immunostaining for Cre in Cck-Cre mice injected with retrograde tracers can verify the identity of CCK-positive neurons projecting to specific brain regions .

These approaches have revealed important neuroanatomical details, such as the observation that over 96% of neurons projecting from the rhinal cortex to the motor cortex are CCK-positive, highlighting the specificity of CCK-mediated circuits in neuronal networks .

What critical controls are necessary for CCKBR functional studies?

Rigorous experimental design for CCKBR functional studies requires several key controls:

  • Vehicle controls: When administering CCKBR ligands, appropriate vehicle controls must be included. For example, in studies using the CCKBR antagonist L365.260, control groups received vehicle (artificial cerebral spinal fluid [ACSF] + 0.1% dimethyl sulfoxide (DMSO)) .

  • Negative controls for genetic/viral manipulations: When using viral vectors for CCKBR manipulation, multiple control groups are essential:

    • Control virus with active compound (e.g., mCherry + clozapine) to rule out non-specific effects of the compound

    • Active virus with vehicle (e.g., hM4Di + saline) to control for effects of viral expression

  • Dose-response relationships: Testing multiple concentrations of compounds to establish dose-dependent effects and therapeutic windows.

  • Time-course studies: Assessing the temporal dynamics of receptor activation and signaling to establish appropriate experimental timelines.

These controls ensure that observed effects can be specifically attributed to CCKBR modulation rather than experimental variables or non-specific effects.

How should researchers design experiments to distinguish CCKBR functions in different tissues?

Distinguishing CCKBR functions across different tissues requires targeted experimental approaches:

  • Tissue-specific genetic manipulations: Using Cre-lox technology with tissue-specific promoters to selectively manipulate CCKBR in specific cell populations.

  • Local pharmacological interventions: Directly delivering CCKBR agonists or antagonists to specific tissues, as demonstrated by implanting drug infusion cannulas into the motor cortex to study CCKBR's role in motor learning .

  • Ex vivo tissue preparations: Utilizing tissue slices or isolated cells from different sources to study CCKBR function under controlled conditions. For example, electrophysiological recordings from motor cortex brain slices have been used to study CCK's effects on long-term potentiation .

  • Pathway-specific manipulations: Targeting specific CCKBR-expressing neuronal pathways, as shown in studies using retrograde Cre virus injection into the motor cortex combined with Cre-dependent hM4Di expression in the rhinal cortex to specifically inhibit CCK-positive projections between these regions .

These approaches allow researchers to dissect tissue-specific functions of CCKBR, which is essential for understanding its diverse roles across different physiological systems.

What statistical approaches are most appropriate for analyzing CCKBR experimental data?

The selection of appropriate statistical methods for CCKBR studies depends on the experimental design:

  • For comparing treatment effects over time: Two-way mixed ANOVA with appropriate post-hoc tests is commonly used. For example, this approach has been applied to analyze the effects of CCKBR antagonists on motor learning over multiple training days .

  • For within-group comparisons across time points: One-way repeated measures ANOVA is appropriate, as demonstrated in studies comparing motor performance across training days within the same treatment group .

  • For direct comparisons between two conditions: Paired t-tests can be applied, as seen in analyses comparing Hausdorff distances of movement trajectories between different days of training .

  • For correlation analyses: Appropriate correlation coefficients to assess relationships between variables, such as neuronal activity patterns and behavioral performance.

Statistical reporting should include both the test statistic (e.g., F = 5.342) and the exact p-value (p = 0.046) to allow readers to fully evaluate the statistical significance .

How can findings from recombinant dog CCKBR studies be translated to human applications?

Translating findings from canine CCKBR studies to human applications requires careful consideration of several factors:

  • Cross-species receptor homology: Understanding the similarities and differences between canine and human CCKBR. The high sequence homology between species suggests conserved functions, but species-specific differences must be considered.

  • Comparative pharmacology: Determining whether ligands that interact with canine CCKBR show similar binding properties and efficacy at the human receptor. Structural studies of human cholecystokinin receptors in complex with various ligands provide valuable comparative data .

  • Physiological context: Assessing whether the physiological processes regulated by CCKBR are conserved across species. While basic mechanisms may be shared, the importance of specific pathways may vary.

  • Therapeutic potential assessment: Evaluating whether targeting CCKBR could have therapeutic value in human conditions. Despite promising preclinical findings, many clinical trials targeting CCKAR or CCKBR have been terminated at different phases due to low efficacy or poor bioavailability in patients .

These considerations highlight the complexities of translational research and emphasize the need for comprehensive understanding of receptor biology across species.

What methodological approaches can resolve contradictory findings in CCKBR research?

Resolving contradictory findings in CCKBR research requires systematic methodological approaches:

  • Standardized experimental protocols: Developing consistent protocols for receptor expression, ligand preparation, and functional assays to minimize technical variability.

  • Direct comparative studies: Conducting side-by-side comparisons of different methodologies within the same laboratory to identify sources of variability.

  • Comprehensive pharmacological profiling: Testing multiple ligands across a range of concentrations to develop complete pharmacological profiles rather than relying on single-point measurements.

  • Multi-modal validation: Applying complementary techniques to verify findings. For example, combining binding studies, signaling assays, and functional outcomes provides more robust evidence than any single approach.

  • Replication studies: Independent replication of key findings by different research groups is essential for establishing scientific consensus.

These methodological approaches can help resolve contradictions and build a more coherent understanding of CCKBR biology.

How can researchers address challenges in developing selective CCKBR ligands?

Developing selective CCKBR ligands presents several challenges that can be addressed through systematic approaches:

  • Structure-based drug design: Utilizing the structural information from cryo-EM and crystallography studies of CCKBR complexes to identify key binding pocket features that can be exploited for selectivity .

  • Focused medicinal chemistry: Systematically modifying lead compounds to optimize selectivity for CCKBR over related receptors, particularly CCKAR.

  • Blood-brain barrier considerations: For CNS applications, compounds must be designed to cross the blood-brain barrier. CCK4 (Trp-Met-Asp-Phe-NH2) has been specifically used as a CCKBR agonist because it can pass through this barrier .

  • Allosteric modulators: Developing compounds that bind to allosteric sites rather than the orthosteric binding pocket may offer greater selectivity.

  • Biased ligand development: Creating ligands that preferentially activate specific signaling pathways downstream of CCKBR may provide functional selectivity even without absolute receptor selectivity.

The challenges in developing selective CCKBR ligands are highlighted by the termination of many clinical trials targeting these receptors due to low efficacy or poor bioavailability , emphasizing the need for continued research in this area.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.