Recombinant Dog Histamine H2 receptor (HRH2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The canine HRH2 gene encodes a 359-amino acid protein with 83–95% sequence homology across mammals . Key features include:

  • Chromosomal location: 5q35.5 in humans (orthologous region in dogs)

  • Molecular weight: ~40 kDa

  • Structural motifs: Seven transmembrane domains, constitutive activity, and a COOH terminus critical for agonist-induced internalization

Table 2: Functional Data from Transfected Cells

ParameterResult (CHO Cells Expressing Canine HRH2)Source
cAMP EC₅₀ for Histamine10⁻⁹–10⁻⁴ M (dose-dependent)
Tiotidine Binding Loss25% reduction after 60-min histamine exposure
Cross-Talk with H1RAttenuates H1R-mediated IP₃ signaling

Research Applications

Recombinant dog HRH2 has been pivotal in:

  1. Mechanistic Studies:

    • Elucidating GPCR desensitization pathways via GRK2/3 phosphorylation

    • Investigating heterodimerization with H1 receptors, which alters trafficking and signaling outcomes

  2. Drug Development:

    • Validating H2 antagonists (e.g., ranitidine) that reduce gastric acid secretion in canine models

    • Testing fluorescent ligands (e.g., NanoBRET assays) for high-throughput receptor-ligand interaction studies

Expression Systems and Reagents

Canine HRH2 is commercially available in multiple recombinant formats:

Table 3: Available Recombinant HRH2 Proteins

Host SystemApplicationsSupplier
Chinese Hamster OvarycAMP assays, desensitization studiesCreative BioMart
HEK293Structural studies, ligand screeningCUSABIO
Insect Cells (Sf9)Large-scale protein productionCreative BioMart

Clinical and Pathological Relevance

  • Gastrointestinal Disorders: HRH2 dysfunction correlates with peptic ulcers and gastroesophageal reflux .

  • Cancer Research: Elevated HRH2/HRH1 expression ratios in colorectal cancer predict improved patient survival .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HRH2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MISNGTGSSFCLDSPPCRITVSVVLTVLILITIAGNVVVCLAVGLNRRLRSLTNCFIVSL AITDLLLGLLVLPFSAFYQLSCRWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV TDPLRYPVLITPVRVAVSLVLIWVISITLSFLSIHLGWNSRNETSSFNHTIPKCKVQVNL VYGLVDGLVTFYLPLLVMCITYYRIFKIARDQAKRIHHMGSWKAATIGEHKATVTLAAVM GAFIICWFPYFTVFVYRGLKGDDAINEAFEAVVLWLGYANSALNPILYATLNRDFRTAYQ QLFRCRPASHNAQETSLRSNSSQLARNQSREPMRQEEKPLKLQVWSGTEVTAPRGATDR
Uniprot No.

Target Background

Function
The H2 subclass of histamine receptors mediates gastric acid secretion. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References Into Functions
  1. Histamine H receptor blockade preserves cardiac systolic function in dogs with pacing-induced heart failure, even in the presence of beta-adrenergic receptor blockade. PMID: 20852875
  2. histamine H(2) receptors have roles in anaerobic myocardial metabolism and in ischemia and reperfusion injury PMID: 16603184
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Gastric fundus and, to a lesser extent, in brain.

Q&A

What is the canine histamine H2 receptor and how does it functionally compare to other species?

The canine histamine H2 receptor (cH2R) is a G-protein coupled receptor that exhibits unique pharmacological properties compared to other species. Unlike human (hH2R), guinea pig (gpH2R), and rat (rH2R) variants, the canine H2 receptor demonstrates significantly increased constitutive activity . This elevated basal activity is characterized by:

  • Higher efficacies of partial agonists

  • Increased potencies of agonists (correlated with corresponding efficacies at human H2R)

  • Increased inverse agonist efficacies

  • Decreased potencies of antagonists

When expressed in Sf9 insect cells as fusion proteins with G(salphaS), cH2R shows the highest basal and GTP-dependent increases in adenylyl cyclase activity, providing a clear marker of its enhanced constitutive activity . This fundamental characteristic has significant implications for comparative pharmacological studies and drug development.

Where are H2 receptors distributed in the canine gastrointestinal tract?

H2 receptors are widely distributed throughout the canine gastrointestinal tract, showing distinct patterns that correlate with their physiological functions. Immunohistochemical studies using specific antibodies have revealed:

  • H2 receptors are present in all sections of the canine gastrointestinal tract

  • Highest staining intensity is observed in the gastric mucosa

  • Distribution patterns similar to those observed in the normal human gastrointestinal tract

This widespread distribution underlies the diverse physiological roles of H2 receptors in gastrointestinal function, including acid secretion regulation and vascular responses. For researchers, understanding this distribution pattern is essential for designing targeted studies of specific GI regions or for interpreting regional differences in H2 receptor-mediated responses.

What methods are available for measuring H2 receptor levels in dogs?

Several validated methodologies are available for quantifying H2 receptor levels in canine samples:

  • Immunoenzymatic Assay (ELISA): Commercial detection kits specific for canine H2 receptors (e.g., Canine HRH2-ELISA Kit) can measure receptor concentrations in both serum and tissue homogenates with high sensitivity (0.1 ng/ml). This biotin double-antibody sandwich technology provides reliable quantification with intra-assay CV less than 10% and inter-assay CV less than 15% .

  • Western Blot: This technique confirms ELISA results and can detect H2 receptors using canine-specific polyclonal antibodies. The method provides qualitative confirmation of receptor expression .

  • Immunohistochemistry: Standard techniques using commercially available histamine receptor antibodies predicted to react with canine tissues can identify the distribution and relative abundance of H2 receptors in different tissue sections .

These complementary approaches allow researchers to conduct comprehensive analyses of H2 receptor expression levels and distribution patterns.

What is the relationship between H2 receptor levels in serum and tissue samples in dogs?

A key finding for researchers is that H2 receptor concentrations in canine serum closely correlate with concentrations in gastric wall tissue. In a preliminary comparative study:

Sample TypeMedian H2R Concentration (ng/ml)Interquartile Range (ng/ml)
Serum1.4731.30-1.79
Gastric Wall1.4981.33-1.85

No statistically significant difference was detected between serum and gastric wall tissue H2 receptor levels . This correlation has important methodological implications for researchers:

  • Non-invasive serum sampling can serve as a reliable proxy for tissue H2 receptor levels

  • Reduction in animal suffering by avoiding unnecessary tissue sampling

  • Potential for longitudinal studies using sequential blood sampling

This finding significantly streamlines experimental design while maintaining data integrity.

How do H2 receptors mediate physiological responses in the canine cardiovascular system?

In dogs, H2 receptors play distinctive roles in cardiovascular regulation that can be clearly distinguished from H1 receptor-mediated effects:

  • H2 receptors mediate vasodilation, tachycardia, and increased cardiac output in response to histamine

  • H1 receptors mediate vasoconstrictor and minimal cardiac depressant actions

  • Histamine stimulates only H1 and H2 receptors in the canine cardiovascular system, as combined H1 and H2 receptor antagonism prevents almost all cardiovascular responses to histamine

These findings, demonstrated through selective receptor blockade experiments, provide a clear framework for understanding the differential roles of histamine receptor subtypes in canine cardiovascular physiology.

What molecular mechanisms underlie the increased constitutive activity of canine H2 receptors compared to other species?

The enhanced constitutive activity of canine H2 receptors represents a significant species variation that provides opportunities for structure-function studies. This increased activity manifests through several measurable parameters:

  • In GTPase activity assays, cH2R-G(salphaS) demonstrates hallmarks of increased constitutive activity not observed in gpH2R-G(salphaS) or rH2R-G(salphaS)

  • Metiamide acts as an inverse agonist at hH2R-G(salphaS), gpH2R-G(salphaS), and rH2R-G(salphaS) but functions as a weak partial agonist with decreased potency at cH2R-G(salphaS)

For researchers investigating the molecular basis of this phenomenon, experimental approaches should include:

  • Site-directed mutagenesis of specific amino acid residues that differ between canine and human H2 receptors

  • Creation of chimeric receptors with domains from different species

  • Molecular dynamics simulations to identify conformational differences

  • Investigation of interaction patterns with various G proteins

Since H2R species variants are structurally very similar, comparative studies are particularly valuable to relate different functional properties to specific molecular determinants .

How does desensitization affect canine H2 receptor function and what methodological approaches are best for studying this phenomenon?

Desensitization is a critical regulatory mechanism that affects H2 receptor signaling. In experimental systems using recombinant canine H2 receptors:

  • Preincubation of transfected Chinese hamster ovary cells with 10 μM histamine for 10 or 60 minutes at 37°C decreases both the maximal response and sensitivity of subsequent histamine-stimulated cAMP production

  • Tiotidine (H2 receptor antagonist) binding decreases by 25% in intact cells following desensitization

  • Similar decreases in tiotidine binding are observed in membrane preparations without changes in binding affinity

  • No decrease in total H2 receptor number occurs, indicating that desensitization is associated with receptor sequestration rather than degradation

For researchers investigating this phenomenon, optimal methodological approaches include:

  • Radioligand binding assays: To quantify changes in surface receptor availability

  • cAMP accumulation assays: To measure functional consequences of desensitization

  • Fluorescence microscopy with tagged receptors: To track receptor internalization

  • Pulse-chase experiments: To distinguish between sequestration and degradation

Understanding these mechanisms is essential for interpreting changes in drug responsiveness over time.

How do H2 receptor levels change in canine disease states and what methodologies are best for investigating these changes?

Significant differences in H2 receptor levels exist between healthy dogs and those with gastrointestinal pathology. A comparative study revealed:

Dog GroupMedian H2R Concentration (ng/ml)Interquartile Range (ng/ml)
Healthy (Group 1)1.501.30-1.83
GI Disease (Group 2)2.402.17-2.62

Dogs with gastroenteric symptoms showed markedly higher concentrations of H2 receptors both in serum and stomach wall (p<0.001) . This finding has important implications:

  • Higher H2 receptor levels may contribute to greater efficacy of ranitidine treatment in dogs with acute vomiting

  • H2 receptor quantification may serve as a biomarker for certain gastrointestinal conditions

  • Therapeutic approaches targeting H2 receptors may require adjustment based on receptor expression levels

For investigating these changes, optimal methodological approaches include:

  • Paired serum-tissue sampling: To confirm correlation in pathological states

  • Longitudinal studies: To track receptor changes during disease progression and recovery

  • Correlation analyses: To relate receptor levels to specific symptoms or disease markers

  • Pharmacodynamic studies: To evaluate how altered receptor levels affect drug responses

Interestingly, short-term ranitidine administration did not significantly alter H2 receptor concentrations, suggesting stable receptor expression despite antagonist treatment .

What expression systems are most effective for producing functional recombinant canine H2 receptors for research purposes?

Selecting appropriate expression systems is critical for studying recombinant canine H2 receptors. Based on the literature:

  • Sf9 insect cells: Successfully used for expressing fusion proteins of cH2R and G(salphaS), allowing assessment of receptor-mediated GTPase activity and adenylyl cyclase stimulation .

  • Chinese hamster ovary (CHO) cells: Effectively express canine H2 receptor DNA using appropriate expression vectors, as demonstrated by:

    • Immunoblotting with specific antibodies

    • Binding of tiotidine (H2 receptor antagonist)

    • Histamine-stimulated cAMP production in a dose-dependent manner (10^-9 to 10^-4 M)

When designing expression systems for canine H2 receptors, researchers should consider:

  • Selection of appropriate promoters for optimal expression levels

  • Addition of epitope tags for detection without interference with function

  • Co-expression with relevant G proteins to study coupling efficiency

  • Development of stable cell lines for reproducible experiments

Each system offers advantages depending on the specific research question, with insect cells typically providing higher expression levels and mammalian cells offering more physiologically relevant post-translational modifications.

How can researchers design experiments to differentiate between H1 and H2 receptor-mediated effects in canine cardiovascular studies?

Differentiating between H1 and H2 receptor-mediated cardiovascular effects requires careful experimental design. Effective methodological approaches include:

  • Selective receptor blockade:

    • H2-receptor blockade with metiamide prevents systemic vasodilation and potentiates pulmonary vasoconstriction induced by histamine

    • H1-receptor blockade with chlorpheniramine augments systemic vasodilation, prevents pulmonary vasoconstriction, and increases cardiac output and heart rate responses

  • Combined receptor blockade:

    • Combined H1 and H2 receptor antagonism prevents almost all cardiovascular actions of histamine, indicating that histamine stimulates only these two receptor subtypes in the canine cardiovascular system

  • Tissue-specific measurements:

    • Separate monitoring of pulmonary and systemic vascular beds reveals differential receptor distribution

    • Simultaneous measurement of cardiac parameters (output, rate) and vascular resistance

  • Dose-response analysis:

    • Construction of complete dose-response curves before and after selective receptor blockade

    • Calculation of pA2 values for antagonists to confirm receptor subtype involvement

This systematic approach enables precise characterization of the distinct roles of H1 and H2 receptors in the complex cardiovascular responses to histamine.

What are the challenges in characterizing ligand selectivity for canine H2 receptors and how can they be addressed?

Ligand selectivity studies with canine H2 receptors present unique challenges due to species-specific variations in pharmacological responses. Key considerations include:

  • Species-specific pharmacology:

    • Metiamide acts as an inverse agonist at human, guinea pig, and rat H2 receptors but functions as a weak partial agonist with decreased potency at canine H2 receptors

    • These differences suggest distinct ligand-specific conformations in H2 receptor species isoforms

  • Methodological approaches to address these challenges:

    • Comparative pharmacological profiling: Testing compounds across multiple species variants to identify dog-specific response patterns

    • Radioligand displacement studies: Determining binding affinities for various ligands at canine versus other species' H2 receptors

    • Functional assays: Measuring downstream signaling (cAMP, GTPase activity) to characterize full agonists, partial agonists, and inverse agonists

    • Molecular modeling: Predicting ligand-receptor interactions based on species-specific amino acid differences

  • Data interpretation frameworks:

    • Use of standardized parameters (EC50, Emax, pA2) to enable cross-study comparisons

    • Implementation of operational models to quantify efficacy differences

    • Development of allosteric binding models when appropriate

Understanding these species variations is essential for translational studies and for developing compounds with optimized activity in canine systems.

What techniques are recommended for investigating the molecular basis of constitutive activity in canine H2 receptors?

The enhanced constitutive activity of canine H2 receptors compared to other species provides an excellent model for studying the molecular determinants of GPCR basal activity. Recommended techniques include:

  • Steady-state GTPase activity assays:

    • These assays have successfully revealed the hallmarks of increased constitutive activity in cH2R-G(salphaS) compared to hH2R-G(salphaS)

    • Key parameters to measure include increased efficacies of partial agonists, increased potencies of agonists, increased inverse agonist efficacies, and decreased antagonist potencies

  • Adenylyl cyclase activity measurements:

    • In membranes expressing non-fused H2Rs with or without mammalian G(salphaS) or H2R-G(salpha) fusion proteins, canine H2R shows the highest basal and GTP-dependent increases in adenylyl cyclase activity

    • This provides a sensitive readout of constitutive activity

  • Site-directed mutagenesis approaches:

    • Since H2R species variants are structurally very similar, focused mutagenesis of divergent amino acids can identify specific residues responsible for enhanced constitutive activity

    • Creation of reciprocal mutations (dog→human and human→dog) can confirm the functional significance of identified residues

  • Structural biology techniques:

    • Cryo-electron microscopy of receptors in various conformational states

    • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered conformational dynamics

These approaches enable systematic investigation of the molecular basis for species differences in H2 receptor constitutive activity, contributing to our fundamental understanding of GPCR activation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.