Recombinant Dog Interleukin-2 receptor subunit alpha (IL2RA)

Basic Research Questions

• What is canine IL2RA and what role does it play in immune signaling?

  Canine IL2RA, also known as CD25, is the alpha subunit of the interleukin-2 receptor complex expressed primarily on activated T lymphocytes. It functions as part of a trimeric receptor complex that mediates IL-2 signaling, which is crucial for T-cell proliferation, differentiation, and function in dogs.

  The protein exists in two forms: a membrane-bound form (approximately 55 kDa) and a soluble form (sIL-2r, approximately 45 kDa) that is released from lymphocyte surfaces . The soluble form is detectable in canine serum and has significant clinical implications as a biomarker for lymphoproliferative diseases. The membrane-bound form contributes to high-affinity IL-2 binding and subsequent signal transduction pathways that regulate immune responses in canines.

  Functionally, IL2RA expression increases dramatically following T-cell activation, converting the intermediate-affinity IL-2 receptor to a high-affinity receptor complex, thereby enhancing cellular responsiveness to IL-2. This process is fundamental to mounting effective immune responses against pathogens and tumors in dogs.

• What are the structural characteristics of recombinant dog IL2RA?

  Recombinant dog IL2RA consists of the mature protein sequence spanning amino acids 22-268 of the full-length protein . The full amino acid sequence of canine IL2RA mature protein is: DLCDDDPPNLKHATFKALTYKTGTVLNCDCERGFRRISSYMHCTGNSSHASWENKCRCKSVSPENRKGKVTTKPEEQKGENPTEMQSQTPPMDEVDLVGHCREPPPWEHENSKRIYHFVVGQTLHYQCMQGFTALHRGPAKSICKTIFGKTRWTQPPLKCISESQFPDDEELQASTDAPAGRDTSSPFITTSTPDFHKHTEVATTMESFIFTTEYQIAVASCVLLLISIVLLSGLTWQRRRRKSRTI .

  The protein contains several key structural domains:

  • An extracellular domain that binds IL-2

  • A transmembrane region

  • A short cytoplasmic tail

  The extracellular portion contains multiple cysteine residues that form disulfide bonds critical for proper protein folding and functionality. When expressed in recombinant systems, tags such as histidine may be added to facilitate purification while maintaining biological activity. Notably, the soluble form detected in canine serum (approximately 45 kDa) is smaller than the membrane-bound form (approximately 55 kDa), suggesting post-translational modification or alternative processing during release from the cell surface .

• How can recombinant dog IL2RA be expressed and purified for research applications?

  Expression and purification of recombinant dog IL2RA can be achieved through several systems, with bacterial and mammalian expression being the most common methodologies.

  Bacterial Expression Methodology:

  • Clone the cDNA encoding mature canine IL2RA (amino acids 22-268) into a suitable expression vector such as pRSET

  • Transform into an E. coli expression strain

  • Induce protein expression under optimized conditions (temperature, IPTG concentration)

  • Lyse cells and purify using affinity chromatography, typically with Ni-NTA resin for His-tagged proteins

  • Perform buffer exchange to remove imidazole and prepare for downstream applications

  • Analyze purity using SDS-PAGE (should achieve >90% purity)

  Mammalian Expression Methodology:

  • Clone full-length canine IL2RA cDNA into a mammalian expression vector such as pcDNA3.1

  • Transfect mammalian cells (e.g., COS-7 cells) using standard transfection protocols

  • Collect supernatant containing secreted protein (for soluble forms) or lyse cells (for membrane-bound forms)

  • Purify using appropriate affinity chromatography

  • Store in stabilizing buffer, often containing trehalose at 6% to maintain stability

  For long-term storage, recombinant IL2RA is typically lyophilized or stored at -20°C/-80°C with glycerol (recommended at 5-50% final concentration) to prevent freeze-thaw damage .

• What are the differences between membrane-bound and soluble forms of canine IL2RA?

  The membrane-bound and soluble forms of canine IL2RA exhibit distinct characteristics that impact their biological functions and research applications.

  Physical Properties:

  • Membrane-bound IL2RA: Approximately 55 kDa protein anchored in the lymphocyte cell membrane

  • Soluble IL2RA (sIL-2r): Approximately 45 kDa protein found in circulation

  Origin and Generation:
  Soluble IL-2r is directly released from the surface of lymphocytes expressing the IL-2 receptor alpha chain (CD25) . This process likely involves proteolytic cleavage of the extracellular domain, explaining the lower molecular weight compared to the membrane-bound form.

  Functional Distinctions:
  Membrane-bound IL2RA forms part of the high-affinity IL-2 receptor complex essential for IL-2 signaling, while soluble IL-2r can potentially act as a decoy receptor, binding free IL-2 and modulating its availability for cellular signaling.

  Clinical Significance:
  Serum sIL-2r levels serve as biomarkers for lymphoproliferative diseases in dogs, with significantly higher levels detected in animals with multicentric high-grade B-cell lymphoma compared to healthy dogs . Changes in serum sIL-2r levels parallel changes in tumor mass and lymph node size, suggesting utility in monitoring disease progression and treatment response .

• How can researchers detect and quantify canine IL2RA expression in biological samples?

  Multiple methodologies exist for detecting and quantifying canine IL2RA in biological samples, each with specific applications in research settings:

  Enzyme-Linked Immunosorbent Assay (ELISA):

  • Sandwich ELISA methods have been specifically developed for quantifying canine serum sIL-2r

  • This approach utilizes capture antibodies specific for canine IL2RA and detection antibodies conjugated to an enzyme

  • Provides quantitative measurement of IL2RA concentration in serum or tissue homogenates

  Immunoprecipitation (IP):

  • Effective for detecting IL2RA in complex biological samples

  • Has successfully identified the 45 kDa soluble form in canine serum

  • Can be combined with Western blotting for size determination and semi-quantitative analysis

  Flow Cytometry:

  • Allows quantification of membrane-bound IL2RA expression on individual cells

  • Enables simultaneous analysis of multiple cell surface markers

  • Useful for monitoring changes in IL2RA expression following in vitro stimulation

  Reverse Transcription-Polymerase Chain Reaction (RT-PCR):

  • Enables detection of IL2RA mRNA expression

  • Can be used with canine peripheral blood mononuclear cells (PBMCs) stimulated with concanavalin A (10 μg/mL for 24 hours)

  • Provides insight into transcriptional regulation of IL2RA

  When selecting a detection method, researchers should consider the specific form of IL2RA they wish to study (membrane-bound vs. soluble) and the type of information needed (protein quantity, cellular distribution, or gene expression).