Recombinant Dog Inward rectifier potassium channel 2 (KCNJ2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
KCNJ2; IRK1; Inward rectifier potassium channel 2; Cardiac inward rectifier potassium channel; Inward rectifier K(+ channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
KCNJ2
Target Protein Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDLDLHNQASVPLEPRP LRRESEI
Uniprot No.

Target Background

Function

KCNJ2 likely plays a role in establishing action potential waveform and excitability in neuronal and muscle tissues. Inward rectifier potassium channels exhibit a preferential inward potassium flux. Their voltage dependence is modulated by extracellular potassium concentration; increased extracellular potassium shifts the channel opening to more positive voltages. Inward rectification primarily results from internal magnesium blockage. External barium or cesium block the channel.

Gene References Into Functions
  1. Regional variations in Kir2 expression likely account for regional differences in inward rectifier potassium current characteristics. PMID: 25889894
  2. Congestive heart failure upregulates fibroblast KCNJ2 expression and currents, leading to hyperpolarization of the resting membrane potential, increased Ca2+ entry, and enhanced atrial fibroblast proliferation. Remodeling-induced fibroblast KCNJ2 may contribute to atrial fibrillation. PMID: 25608527
  3. Increased inward rectifier potassium channel mRNA expression is observed after subarachnoid hemorrhage. PMID: 16079788
Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Lipid-anchor.

Q&A

Basic Research Questions

  • What is the gene structure of canine KCNJ2?

    The canine KCNJ2 gene consists of two exons, with the complete open reading frame (ORF) located on the second exon. Experimental mapping using RT-PCR, 5'-RACE, and 3'-RACE has identified one transcription initiation site and four differential transcription termination sites found downstream of two consensus polyadenylation signals . The gene structure is conserved amongst vertebrates, although current GenBank gene annotation may be incomplete. Exon/intron boundaries conform to consensus splice sites, showing high homology when compared with mouse and chicken sequences .

  • How does canine KCNJ2 differ from KCNJ12 in terms of gene structure?

    While KCNJ2 consists of two exons with its ORF on the second exon, KCNJ12 (encoding Kir2.2) has a three-exon structure with its ORF located on the third exon . Both genes have been experimentally mapped in canine heart tissue. No alternative splicing has been observed for either gene in canine right ventricle or brain cortex, suggesting tissue-specific expression rather than alternative splicing as a regulatory mechanism . This difference in gene architecture reflects their distinct evolutionary origins despite functional similarities.

  • What functional roles do Kir2.1 channels play in canine cardiac physiology?

    Kir2.1 channels are critical components for:

    • Terminal cardiac repolarization (phase 3 of the action potential)

    • Maintaining resting membrane stability in cardiomyocytes

    • Supporting balanced cardiac excitability

    • Allowing Na+ channel recovery from inactivation

    The outward component of IK1 (not the inward component emphasized historically) plays the physiologically relevant role in cardiac electrical stability . Defects in Kir2.1 function, whether through "gain-of-function" or "loss-of-function" mutations, can lead to genetic sudden cardiac death syndromes .

  • How are inward rectifier currents measured in canine cardiac tissue?

    Inward rectifier currents (IK1) in canine cardiac tissue can be measured using:

    • Whole-cell patch-clamp recordings with voltage steps from negative to positive potentials

    • Application of Ba2+ (1-100 μM) to isolate IK1 through its specific blockade

    • Manipulation of extracellular [K+] to alter EK and identify IK1 through its K+-dependence

    • Single-channel recordings to determine unitary conductance (approximately 13 pS)

    In experimental settings, cells near the submucosal surface in full-thickness strips of colonic muscle showed resting membrane potentials of -70.0 ± 0.9 mV, with Ba2+ causing concentration-dependent depolarization (10-100 μM) and reduced amplitude and frequency of slow waves .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.