Recombinant Dog Lens fiber major intrinsic protein (MIP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dog Lens Fiber Major Intrinsic Protein (MIP)

Recombinant Dog Lens Fiber Major Intrinsic Protein (MIP) is a protein that has been engineered through recombinant DNA technology. This protein is a crucial component of the lens fiber cell membranes in dogs and plays a significant role in maintaining lens transparency and facilitating water transport across cell membranes. MIP is also known as Aquaporin-0 (AQP0) and belongs to the aquaporin family of water channels.

Structure and Function

MIP is a hydrophobic, transmembrane protein consisting of 263 amino acids. It forms a characteristic "hourglass" structure with six plasma membrane-spanning α-helices, which is typical of aquaporins. This structure includes two tandem repeats, each containing an amino- and carboxy-terminal "hemi-pore" with a highly conserved Asn-Pro-Ala (NPA) motif. These motifs are essential for forming functional water pores .

MIP monomers assemble into homo-tetramers, which are crucial for its function as a water channel. In addition to facilitating water transport, MIP also forms thin junctions between lens fiber cells, which help minimize light scattering by collapsing the extracellular space .

Recombinant Expression

The recombinant full-length dog lens fiber MIP protein is expressed in Escherichia coli (E. coli) and is fused with an N-terminal His tag for easy purification. This recombinant protein is available as a lyophilized powder with a purity of greater than 90% as determined by SDS-PAGE .

Research Findings and Applications

MIP is a key protein in lens fiber cells, constituting about 40% of the plasma membrane proteins. It plays a crucial role in water transport across lens cortical fiber cell membranes, accounting for about 80% of this transport . The protein's water channel activity is influenced by pH and calcium ion concentration in a calmodulin-dependent manner .

In research settings, recombinant MIP proteins are used to study lens biology and pathologies. For instance, ELISA kits are available for detecting MIP levels in various samples, including cell culture supernatants, plasma, serum, and tissue homogenates .

References Creative Biomart. Recombinant Full Length Dog Lens Fiber Major Intrinsic Protein (MIP) Protein, His-Tagged. IOVS. Transcriptome analysis of lens epithelial explants upon vitreous exposure. PMC. Focus on Molecules: Major Intrinsic Protein. Antibodies-online. Dog MIP ELISA Kit (ABIN989170). PMC. The Immediate Early Response of Lens Epithelial Cells to Lens Injury. PubMed. The major intrinsic protein (MIP) of the bovine lens fiber membrane.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes, and we will strive to fulfill your requirements.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is defined during production. If you have a specific tag preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
MIP; AQP0; Lens fiber major intrinsic protein; Aquaporin-0
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
MIP
Target Protein Sequence
MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWTPGPLHVLQVALAFGLALATLVQAVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPGVSVGQATTVEIFLTLQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGARPSDSNGQPEGTGEPVELKTQAL
Uniprot No.

Target Background

Function
This protein serves as a water channel. Its activity is down-regulated by calmodulin (CALM) when cytoplasmic Ca(2+) levels rise. It may play a role in regulating lens osmolarity. Interactions between homotetramers from adjacent membranes potentially stabilize cell junctions within the eye lens core. This protein is implicated in cell-to-cell adhesion and facilitates gap junction coupling.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the structure and function of canine Major Intrinsic Protein (MIP)?

MIP is a 28 kDa integral membrane protein (approximately 263 amino acids) that forms tetramers containing four independent water channels. The protein contains six transmembrane domains (H1-H6), three extracellular loops (A, C, and E), two intracellular loops (B and D), and intracellular N and C termini . The C-terminal segment spans 44 amino acids (residues 220-263) and features an α-helix (residues 230-238) with an overlapping calmodulin-binding domain (residues 223-235) .

Functionally, MIP serves three primary roles:

  • Water and small neutral solute transport across lens fiber cell membranes

  • Cell adhesion between lens fiber cells via interactions with crystallins and connexin 50

  • Structural organization of lens fibers essential for transparency

While MIP functions as a water channel, it is relatively less efficient compared to other aquaporins, suggesting its cell adhesion role may be equally important for lens transparency .

What expression systems are most suitable for producing recombinant dog MIP?

Recombinant dog MIP can be produced using several expression systems, each with distinct advantages:

E. coli-based expression:

  • Advantages: High yield, cost-effective, rapid production

  • Limitations: Lack of post-translational modifications, potential for inclusion body formation requiring refolding

  • Methodology: Use of pET vector systems with BL21(DE3) cells, induction with IPTG at low temperatures (16-20°C), membrane protein extraction using mild detergents like n-dodecyl-β-D-maltoside (DDM)

Mammalian cell expression:

  • Advantages: Proper folding and post-translational modifications

  • Systems: HEK293 or CHO cells with tetracycline-inducible promoters

  • Purification: Affinity chromatography using His-tag or FLAG-tag fusion proteins

Insect cell expression:

  • Baculovirus-infected Sf9 or High Five cells provide a compromise between bacterial and mammalian systems

  • Enhanced membrane protein expression while maintaining proper folding

For functional studies, mammalian cell systems are preferred as they allow for proper trafficking and post-translational modifications essential for MIP function .

How can researchers verify the identity and purity of recombinant dog MIP?

Multiple complementary approaches should be used:

  • SDS-PAGE analysis: Purified MIP should appear at ~28 kDa, with tetramers visible under certain conditions

  • Western blotting: Using antibodies specific to MIP or epitope tags

  • Mass spectrometry: For definitive protein identification and detection of post-translational modifications

  • Circular dichroism: To confirm proper secondary structure with high alpha-helical content

  • Size-exclusion chromatography: To assess oligomeric state and homogeneity

  • Crystallin αB co-immunoprecipitation: To verify binding capability, as MIP should interact with crystallin proteins

What are established methods for studying MIP trafficking in lens cell models?

Cell culture systems:

  • Established canine lens epithelial cell lines such as CLC-1 can be used as models

  • Primary lens epithelial cells (pLECs) isolated from dog lenses provide physiologically relevant systems

Trafficking analysis methods:

  • Fluorescent protein tagging: GFP-MIP fusion proteins can track real-time trafficking

  • Immunofluorescence microscopy: Using anti-MIP antibodies to visualize localization

  • Surface biotinylation assays: To quantify plasma membrane expression

  • Subcellular fractionation: To determine MIP distribution among cellular compartments

Induction of differentiation:

  • FGF-2 treatment can trigger lens epithelial cell differentiation, inducing MIP expression in a concentration-dependent manner through ERK1/2 and JNK signaling pathways

  • Specific inhibitors (UO126 for ERK1/2 and SP600125 for JNK) can be used to modulate this process experimentally

How do mutations in canine MIP correlate with cataract formation, and what experimental systems best model these defects?

Mutations in MIP have been linked to autosomal dominant cataracts with diverse phenotypes across species, including humans and other mammals . While specific dog MIP mutations have not been extensively characterized in the literature, research approaches can be adapted from studies in other species:

Mutation analysis strategies:

  • Sequence alignment shows high conservation of MIP across species, particularly in functional domains

  • Point mutations in conserved regions are most likely to affect protein function

Experimental models:

  • CRISPR/Cas9 gene editing in canine lens epithelial cell lines to introduce specific mutations

  • Lentiviral transduction of mutant MIP constructs into primary lens cells

  • In vitro lens culture systems to observe effects on transparency

  • Transgenic mouse models expressing dog MIP mutants as surrogate systems

Functional impact assessment:

  • Water permeability assays using stopped-flow light scattering or oocyte swelling tests

  • Cell-cell adhesion quantification using atomic force microscopy

  • Protein trafficking analysis via confocal microscopy

  • Structural analysis using advanced techniques like cryo-electron microscopy

Mutations affecting the C-terminal region (particularly the calmodulin-binding domain) may disrupt water permeability regulation in response to Ca²⁺ or interfere with interactions with cytoskeletal proteins and gap junctions .

What methodologies are most effective for characterizing the water channel function of recombinant dog MIP?

Proteoliposome-based permeability assays:

  • Reconstitute purified recombinant MIP into liposomes

  • Subject proteoliposomes to osmotic gradients

  • Measure water flux using:

    • Stopped-flow light scattering

    • Fluorescence self-quenching with entrapped fluorophores

    • Dynamic light scattering to monitor vesicle size changes

Heterologous expression systems:

  • Xenopus oocytes expressing recombinant dog MIP

  • Cell swelling assays under hypotonic conditions

Single-channel recordings:

  • Planar lipid bilayer electrophysiology

  • Atomic force microscopy to characterize channel structure

Comparative analysis:
Research indicates MIP has lower water permeability compared to other aquaporins, suggesting specialized functions in the lens beyond simple water transport . Quantitative comparisons between dog MIP and other species' MIP proteins can reveal evolutionary adaptations specific to canine lenses.

How does TGF-β signaling interact with MIP expression in canine lens cells, and what are the implications for cataract research?

TGF-β is a key factor in triggering epithelial-mesenchymal transition (EMT) in lens epithelial cells, which contributes to posterior capsule opacification (PCO) after cataract surgery . While direct interactions between TGF-β and MIP expression have not been fully characterized in dogs, research methodologies can explore this relationship:

Experimental approaches:

  • Gene expression analysis:

    • Real-time PCR to quantify MIP mRNA levels following TGF-β treatment

    • RNA-seq to identify global transcriptional changes affecting MIP and related proteins

  • Protein analysis:

    • Western blotting to measure MIP protein levels

    • Immunofluorescence to determine subcellular localization changes

  • Signaling pathway investigation:

    • Inhibitor studies targeting SMAD, ERK1/2, and JNK pathways

    • Phosphorylation status of signaling molecules using phospho-specific antibodies

Current findings:

  • TGF-β treatment significantly decreases epithelial markers and increases mesenchymal markers in canine lens epithelial cells (CLC-1)

  • EMT may promote lens epithelial cell proliferation and survival, contributing to cataract pathogenesis

  • Cells committed to EMT show lower expression of epithelial markers and higher expression of mesenchymal markers compared to anterior lens capsule tissue

What molecular mechanisms regulate MIP expression during lens fiber differentiation in dogs?

Lens fiber differentiation involves a complex program of gene expression changes, including upregulation of MIP. Research in rat models has shown that FGF-2 regulates MIP expression during lens epithelial cell differentiation :

Signaling pathways:

  • FGF-2 activates ERK1/2 and JNK pathways, which are required for MIP expression

  • Specific inhibitors UO126 (for ERK1/2) and SP600125 (for JNK) abrogate MIP expression in response to FGF-2

Promoter regulation:

  • The MIP promoter region (-1648/+44) contains response elements for differentiation signals

  • Reporter assays can be used to identify specific transcription factors binding to these regions

Methodological approaches for studying dog MIP regulation:

  • Explant culture systems:

    • Anterior lens capsule explants treated with FGF-2 at varying concentrations

    • Analysis of MIP expression using real-time PCR and immunoblotting

  • Promoter analysis:

    • Cloning of dog MIP promoter regions into reporter constructs

    • Site-directed mutagenesis to identify key regulatory elements

    • ChIP assays to determine transcription factor binding

  • Signaling pathway manipulation:

    • Small molecule inhibitors of MAPK pathways

    • siRNA knockdown of specific signaling components

    • Constitutively active signaling proteins to bypass receptor activation

How can structural studies of recombinant dog MIP inform therapeutic approaches to canine cataracts?

Structural analysis of MIP can reveal how mutations lead to protein dysfunction and cataract formation:

Structural analysis techniques:

  • X-ray crystallography: Requires highly purified, homogeneous protein samples

  • Cryo-electron microscopy: Can visualize MIP in various conformational states

  • Molecular dynamics simulations: To predict effects of mutations on protein structure and function

  • Hydrogen-deuterium exchange mass spectrometry: To map conformational changes and protein interactions

Findings from structural studies:

  • Mutations can cause subtle changes in protein surface properties and intramolecular interactions

  • For example, serine-to-asparagine mutations can introduce additional hydrogen bonds that alter the protein backbone path

  • Hydrophobicity changes in the C-terminal region can affect protein-protein interactions

Therapeutic implications:

  • Structure-based drug design: Targeting specific domains of MIP to prevent misfolding

  • Chaperone therapies: Small molecules that stabilize MIP folding and trafficking

  • Gene therapy approaches: Correction of MIP mutations using CRISPR/Cas9

  • Cell replacement strategies: Differentiation of stem cells expressing normal MIP

Understanding dog MIP structure at atomic resolution can guide the development of interventions that specifically address the molecular basis of canine cataracts, potentially leading to non-surgical treatments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.