Recombinant Dog Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role of Recombinant Dog MC1R

Recombinant dog melanocyte-stimulating hormone receptor (MC1R) refers to a cloned, engineered version of the melanocortin 1 receptor protein expressed in heterologous systems (e.g., HEK293 cells). This receptor, a seven-transmembrane G-protein-coupled receptor (GPCR), regulates melanin synthesis by switching between eumelanin (black/brown) and pheomelanin (red/yellow) production . In dogs, MC1R variants are central to coat color determination, with mutations altering pigment type and distribution .

Functional Regulation

  • Agonist-Dependent Activation: α-MSH binding induces eumelanin synthesis, while antagonists like agouti-related protein (ASIP) or β-defensins inhibit MC1R, promoting pheomelanin .

  • Constitutive Activity: Some MC1R variants exhibit agonist-independent signaling, enabling inverse agonism .

  • UV Sensitivity: Mutations reducing MC1R function correlate with increased UV-induced oxidative damage due to pheomelanin radicals .

Allelic Series and Phenotypic Impact

Allele DesignationDominance HierarchyCoat Color PhenotypeMolecular Basis
E mDominantMelanistic maskGain-of-function mutations
E gDominantGrizzle/dominoPartially dominant gain-of-function
ECodominantBlack/brownWild-type functional receptor
e 1–3RecessiveRed/yellow/creamLoss-of-function mutations

Source: Adapted from VGL test guidelines for MC1R alleles .

Balancing Selection in Kunming Dogs

Studies on Kunming dogs revealed balancing selection at MC1R, maintaining high heterozygosity (48–52%) across populations . This selection likely preserves mixed yellow-black coats. Key findings include:

  • Non-synonymous SNPs: Four missense mutations (p.Ser90Gly, p.Ala105Thr, p.Pro159Gln, p.Met264Val) alter amino acid properties and receptor function .

  • Tajima’s D Values: Positive values (P < 0.01) in both populations indicate deviation from neutral evolution, supporting balancing selection .

CBD103 (K Locus) and MC1R Binding

LigandAffinity (Ki) for Dog MC1RFunctional Impact
CBD103 (wild-type)~150.6 nMCompetes with α-MSH for receptor binding
CBD103ΔG23~34.2 nMDominant black coat due to high-affinity inhibition .

Mechanistic Insights

  • Antagonistic Interactions: CBD103ΔG23 binds MC1R with higher affinity than α-MSH, blocking eumelanin synthesis and promoting pheomelanin .

  • Cross-Species Relevance: Human β-defensins (e.g., HBD3) also bind MC1R, suggesting conserved roles in melanocortin signaling .

Coat Color Genotyping

Commercial assays detect six MC1R alleles (E m, E g, E, e 1–3) to predict phenotypes like domino (e^A/e) or pied (e^A/K B/*) . The R301C variant (e^A) is linked to ancient red phenotypes and occurs at 1.5% frequency in tested breeds .

Recombinant MC1R in Functional Studies

  • Ligand Binding Assays: Recombinant MC1R expressed in HEK293 cells is used to study α-MSH, CBD103, and ASIP interactions .

  • Transgenic Models: Mice expressing CBD103ΔG23 exhibit black coats, validating MC1R’s role in pigment switching .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format preference, kindly indicate your requirement during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MVWQGPQRRLLGSLNGTSPATPHFELAANQTGPRCLEVSIPNGLFLSLGLVSVVENVLVV AAIAKNRNLHSPMYYFIGCLAVSDLLVSVTNVLETAVMLLVEAGALAAQAAVVQQLDDII DVLICGSMVSSLCFLGAIAVDRYLSIFYALRYHSIVTLPRAWRAISAIWVASVLSSTLFI AYYNHTAVLLCLVSFFVAMLVLMAVLYVHMLARARQHARGIARLRKRQHSVHQGFGLKGA ATLTILLGIFFLCWGPFFLHLSLMVLCPQHPICGCVFQNFNLFLTLIICNSIIDPFIYAF RSQELRKTLQEVVLCSW
Uniprot No.

Target Background

Function
This receptor acts as a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. It plays a role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of canine MC1R?

The melanocortin 1 receptor (MC1R) in dogs is a seven transmembrane-spanning domain protein expressed on melanocytes. As a G protein-coupled receptor, it shares structural similarities with other melanocortin receptors but contains species-specific variations that affect ligand binding and signaling properties. The receptor plays a crucial role in melanin synthesis regulation through activation of cyclic adenosine monophosphate (cAMP) signaling pathways .

How does dog MC1R signaling control coat color determination?

Dog MC1R functions as a key regulator in the pigment type-switching mechanism. When activated, MC1R stimulates exclusive production of eumelanin (black/brown pigment), whereas inhibition leads to exclusive production of pheomelanin (yellow/red pigment). This switch mechanism explains why gain-of-function MC1R mutations cause dominant inheritance of black coat coloration. The signaling occurs through cAMP accumulation following receptor activation, though interestingly, some MC1R ligands like β-defensins (CBD103) can influence pigmentation without directly affecting cAMP levels .

What is the binding affinity of various ligands to dog MC1R?

Research has demonstrated variable binding affinities between dog MC1R and different ligands. The table below summarizes comparative binding affinities (nM) for dog MC1R:

LigandDog MC1R Binding Affinity (nM)
Eu-NDP-MSH0.70
ASIP-YY0.59 (0.51-0.95)
CBD103ΔG2337.0 (16.4-61.1)
CBD103221.0 (150.6-398.7)

NDP-MSH (a potent derivative of α-MSH) demonstrates the highest binding affinity, while β-defensin 103 (CBD103) shows significantly lower binding affinity but still influences MC1R function through competitive mechanisms .

What are the most effective expression systems for producing recombinant dog MC1R?

For experimental studies involving dog MC1R, transient transfection of human embryonic kidney (HEK) 293 cells with MC1R expression constructs has proven effective. This system allows for heterologous expression of the receptor in sufficient quantities for binding and functional studies. The expression system should be optimized for proper folding and trafficking of the seven-transmembrane receptor structure to the plasma membrane. Post-translational modifications, particularly glycosylation patterns, should be considered when selecting expression systems, as these can affect receptor pharmacology .

How can researchers verify the functional integrity of recombinant dog MC1R?

Functional verification of recombinant dog MC1R typically involves multiple complementary approaches:

  • Receptor binding assays using labeled ligands (e.g., europium-labeled NDP-MSH)

  • cAMP accumulation assays to assess signaling capability

  • Competitive binding studies with known agonists and antagonists

  • Surface expression analysis using flow cytometry or immunofluorescence

A properly folded and functional dog MC1R should demonstrate specific binding to α-MSH analogs with nanomolar affinity (Kd ≈ 0.70 nM for Eu-NDP-MSH) and trigger cAMP accumulation in response to agonist binding .

What are the optimal protocols for studying ligand-receptor interactions with dog MC1R?

For rigorous characterization of dog MC1R-ligand interactions, researchers should implement the following methodological approach:

First, conduct saturation binding assays using a labeled high-affinity ligand (e.g., Eu-NDP-MSH) to determine receptor density and affinity. Follow with displacement assays using progressively increasing concentrations of test compounds to determine their binding affinities. This approach has been successfully employed to characterize the interaction between dog MC1R and various ligands including ASIP-YY, CBD103, and its variants .

For binding experiments, standardize conditions with consistent temperature (typically 37°C), incubation time (1-2 hours), and buffer composition. Separate bound from free ligand using vacuum filtration or similar techniques. Calculate binding parameters (Kd, Ki) using appropriate mathematical models (Scatchard analysis, nonlinear regression) .

How do binding characteristics differ between dog MC1R and human MC1R?

Significant species-specific differences exist in ligand binding properties between dog and human MC1R. Comparative studies have revealed the following binding characteristics (Kd values in nM):

ReceptorEu-NDP-MSHASIP-YYCBD103ΔG23CBD103HBD1HBD3
Dog MC1R0.700.5937.0221.0NDND
Human MC1R2.590.9519.635.530.013.8

These data demonstrate that dog MC1R has approximately 3.7-fold higher affinity for Eu-NDP-MSH than human MC1R, while human MC1R binds CBD103 with approximately 6.2-fold higher affinity than dog MC1R. Such species differences must be considered when extrapolating findings between model systems .

How do genetic variants affect dog MC1R function?

Genetic variants in canine MC1R can significantly alter receptor function and subsequent pigmentation patterns. The most extensively studied variant is the β-defensin 103 (CBD103) gene, which produces the K locus effect on coat color. The CBD103ΔG23 variant (with a glycine deletion at position 23) binds to MC1R with higher affinity (37.0 nM) than the wild-type CBD103 (221.0 nM) .

This variant functions by competitively inhibiting the ability of Agouti protein to antagonize MC1R signaling, resulting in constitutive MC1R activation and eumelanin production. The mechanism represents a novel component of the melanocortin pathway in dogs that is not characterized in other species .

What experimental approaches effectively assess the functional impact of MC1R variants?

To assess the functional consequences of MC1R variants, researchers should employ:

  • Binding assays comparing wild-type and variant receptors using labeled ligands

  • Signaling assays measuring cAMP accumulation in response to agonist stimulation

  • Competitive binding studies to evaluate interactions between multiple ligands

  • In vivo models (transgenic mice or canine systems) to validate in vitro findings

These approaches have demonstrated that CBD103ΔG23 does not directly stimulate cAMP accumulation like conventional MC1R agonists but instead affects receptor function through competitive binding mechanisms .

How can recombinant dog MC1R be utilized in developing molecular imaging probes?

Recombinant dog MC1R has significant potential for developing targeted molecular imaging probes. Researchers have successfully developed radiolabeled α-MSH analogs, such as 18F-FB-NAPamide, that specifically bind MC1R for PET imaging applications. The peptide NAPamide (Ac-Nle-Asp-His-D-Phe-Arg-Trp-Gly-Lys-NH₂) serves as an effective backbone for creating MC1R-targeted imaging probes .

Methodology for developing such probes typically involves:

  • Synthesizing the peptide with modifications allowing for radioisotope conjugation

  • Radiolabeling with appropriate isotopes (e.g., 18F using N-succinimidyl-4-18F-fluorobenzoate)

  • In vitro validation of receptor binding using cells expressing different levels of MC1R

  • In vivo biodistribution and imaging studies with appropriate controls

These probes have demonstrated the ability to differentiate between tissues with high and low MC1R expression levels, with B16/F10 melanoma cells (high MC1R expression: 21,687 ± 4,171 sites/cell) showing significantly higher uptake compared to A375M cells (low MC1R expression: 400 ± 93 sites/cell) .

What are the methodological considerations for using recombinant dog MC1R in comparative species studies?

When designing comparative studies between dog and other species' MC1R:

  • Account for differences in binding affinities and pharmacological responses between species (as shown in the comparative binding table above)

  • Standardize experimental conditions including expression systems, buffer compositions, and assay temperatures

  • Include appropriate positive and negative controls specific to each species

  • Consider using chimeric receptors to identify specific domains responsible for species differences

Researchers have observed substantial differences in binding affinities across species, with mouse MC1R showing intermediate binding characteristics between dog and human receptors for most ligands .

How does research on dog MC1R inform melanoma research?

Studies on dog MC1R provide valuable insights for melanoma research due to several factors:

First, the molecular mechanisms of MC1R signaling in pigment production are conserved across species, making canine studies relevant to human melanoma biology. Second, MC1R variants influence melanoma susceptibility, with certain variant patterns (particularly R alleles) associated with higher melanoma risk in humans .

Germline MC1R status has been shown to influence somatic mutation burden, with individuals carrying one or two R alleles demonstrating approximately 42% higher somatic C>T mutation counts (a signature linked to sun exposure) compared to non-carriers . This relationship between genetic predisposition and mutation patterns provides a model for studying gene-environment interactions in melanoma development.

What experimental models are most appropriate for studying MC1R in melanoma context?

For melanoma-related MC1R research, several experimental models have proven valuable:

  • Cell lines with varying MC1R expression levels (e.g., B16/F10 with high expression vs. A375M with low expression)

  • Transgenic mouse models expressing dog MC1R variants

  • Patient-derived xenografts maintaining original MC1R expression patterns

  • In vitro binding and signaling assays using recombinant receptors

These models allow for comprehensive evaluation of how MC1R variants affect receptor function, pigmentation, and potentially melanoma development. Careful selection of appropriate models is critical, as MC1R expression levels can vary dramatically between systems (from approximately 400 receptors per cell in A375M cells to over 21,000 receptors per cell in B16/F10 cells) .

How can researchers address non-specific binding issues in MC1R binding assays?

Non-specific binding represents a significant challenge in MC1R binding studies. To address this issue:

  • Include appropriate blocking agents (e.g., BSA at 0.1-1%) in binding buffers

  • Perform parallel binding in the presence of excess unlabeled ligand (100-1000× concentration)

  • Optimize washing procedures to reduce background without disrupting specific binding

  • Consider alternative labeling strategies if a particular label contributes to non-specific interactions

  • Validate binding specificity through competition with structurally distinct ligands

The specific binding should be calculated by subtracting non-specific binding (in presence of excess unlabeled ligand) from total binding, ensuring accurate affinity determinations .

What strategies can overcome expression challenges for recombinant dog MC1R?

Expression of functional recombinant dog MC1R can be challenging due to its multi-transmembrane structure. To improve expression outcomes:

  • Optimize codon usage for the expression system being employed

  • Consider adding N-terminal signal sequences or C-terminal tags that facilitate trafficking

  • Test multiple cell lines (HEK293, CHO, insect cells) to identify optimal expression systems

  • Adjust culture conditions including temperature (30-37°C) and induction parameters

  • Include chemical chaperones (e.g., DMSO, glycerol) during expression to improve folding

  • Validate surface expression using flow cytometry with antibodies against extracellular epitopes or tags

These approaches can significantly improve the yield of properly folded, functional receptor for subsequent experimental applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.