Recombinant Dog Mitochondrial brown fat uncoupling protein 1 (UCP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UCP1; SLC25A7; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MLRAPGSDAPPTLSVRIAAAAGAACLADMITFPLDTAKVRLQIQGEGQGQPPRAPRYRGV LGTVATLARTEGLQKLYSGLPAGLQRQVGFASLRIGLYDSVREWLSPGQGAAASLGSRIS AGVMTGGAAVFIGQPTEVVKVRLQAQSHLHGRKPRYTGTYNAYRIIATTEGLTGLWKGTT PNLMRNVIINCTELVTYDLMKEALVKNHLLADDLPCHFLSALVAGFCTTVLSSPVDVVKT RFVNSVPEQYTSVPNCAMTMLTKEGPLAFFKGFVPSFLRLGSWNVIMFVCFEQLKRELMK SGRTVDCAT
Uniprot No.

Target Background

Function
A mitochondrial protein crucial for thermogenic respiration in brown adipose tissue (BAT) and beige fat. It plays a vital role in non-shivering thermogenesis, responding to temperature and dietary changes, and contributing to energy balance regulation. UCP1 functions as a long-chain fatty acid (LCFA) and proton symporter, transporting one LCFA and one proton across the inner mitochondrial membrane. The hydrophobic tails of LCFAs remain associated with the transporter, resulting in apparent proton transport activated by LCFAs. This dissipates the mitochondrial proton gradient, converting energy from substrate oxidation into heat instead of ATP. UCP1 also regulates mitochondrial reactive oxygen species (ROS) production.
Gene References Into Functions
  1. Chronic treatment with AJ-9677 induced UCP1 in adipocytes, increasing oxygen consumption in response to AJ-9677 stimulation. PMID: 18406437
Database Links

KEGG: cfa:403574

STRING: 9615.ENSCAFP00000005489

UniGene: Cfa.91

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Dog Mitochondrial Brown Fat Uncoupling Protein 1 (UCP1) and what is its primary function?

UCP1 is particularly notable because among the approximately 40 members of the mitochondrial metabolite carrier family, it is the only member capable of translocating protons through the inner membrane of brown adipocyte mitochondria . This unique capability makes UCP1 a critical component in adaptive thermogenesis and energy expenditure regulation.

How does brown adipose tissue (BAT) detection and UCP1 quantification differ in canine research compared to other species?

Detection and quantification of UCP1 in dogs require species-specific methodologies due to structural differences between canine UCP1 and its homologs in other species. The Dog Mitochondrial Brown Fat UCP1 ELISA Kit offers a specific approach to quantify UCP1 in canine samples with a detection range of 78-5000 pg/mL and sensitivity of 34 pg/mL . This sandwich ELISA method allows for accurate measurement in various sample types including serum, plasma, and cell culture supernatants .

When working with canine samples, researchers should be aware that:

  • Sample preparation methods may differ from those used for human or rodent samples

  • Cross-reactivity with UCP1 from other species is minimal, making species-specific kits necessary

  • The distribution and activation of BAT in dogs may follow different patterns than in well-studied rodent models

For experimental validation, researchers should include appropriate positive and negative controls, and verify linearity, recovery, and precision as provided in the kit specifications .

What are the key experimental models used to study UCP1 function in canines?

Several experimental models are employed to study canine UCP1 function:

Experimental ModelApplicationsAdvantagesLimitations
Primary canine brown adipocytesDirect study of physiological UCP1 functionMaintains in vivo signaling pathwaysLimited cell number, variation between isolations
Recombinant UCP1 expression systemsStructure-function studiesControlled expression levels, mutation analysisMay lack regulatory factors present in vivo
Canine cell lines transfected with UCP1Regulatory studies, drug screeningReproducible, amenable to high-throughputMay not recapitulate all aspects of primary cells
In vitro mitochondrial assaysDirect measurement of uncoupling activityQuantitative assessment of functionDisruption of cellular context

When expressing recombinant canine UCP1 in experimental systems, researchers have successfully used mammalian cell expression systems to maintain proper post-translational modifications . Yeast expression systems have also proven effective for studying basic UCP1 function, although they may lack some mammalian-specific regulatory mechanisms .

How is UCP1 activity regulated by free fatty acids in canine brown adipocytes?

UCP1 activity in canine brown adipocytes is tightly regulated by free fatty acids through a sophisticated physiological mechanism. When thermogenesis is required, norepinephrine released by surrounding sympathetic nerve fibers activates β-adrenergic receptors on brown adipocytes, triggering a signaling cascade that increases intracellular cAMP levels . This leads to the activation of protein kinase A and subsequent stimulation of lipolysis, releasing free fatty acids from stored triglycerides .

These free fatty acids serve a dual purpose:

  • They act as substrates for mitochondrial β-oxidation, providing reducing equivalents to the electron transport chain

  • They directly activate UCP1 by binding to the protein and inducing conformational changes that enhance proton conductance

Experimental evidence for fatty acid activation comes from studies where albumin (which binds free fatty acids) was added to isolated brown adipocytes and mitochondria. For example, controlled infusion of palmitate to mimic lipolysis dramatically increases UCP1 proton conductance, decreases membrane potential, and sharply increases respiration . This process creates a feed-forward loop where increased mitochondrial activity generates heat while simultaneously oxidizing the activating fatty acids.

What role does UCP1 play in regulating reactive oxygen species (ROS) in brown adipose tissue?

Beyond its canonical role in thermogenesis, UCP1 plays a critical physiological role in regulating reactive oxygen species (ROS) levels in brown adipose tissue. Research has revealed that UCP1 helps maintain redox homeostasis through several mechanisms:

  • Dissipation of the proton motive force (Δp) by UCP1 reduces the production of ROS by preventing excessive reduction of the electron transport chain components

  • UCP1 activity specifically mitigates ROS production generated through reverse electron transport (RET) through mitochondrial complex I, a major source of ROS in vivo

  • UCP1-dependent uncoupling prevents mitochondrial hyperpolarization that would otherwise promote ROS generation

Experimental evidence demonstrates that UCP1-deficient BAT mitochondria are highly sensitive to calcium overload-induced mitochondrial dysfunction, which can be rescued by reducing ROS levels . This suggests that one of UCP1's physiological functions is to maintain a mitochondrial environment that mitigates ROS-dependent dysfunction in vivo .

Methodologically, researchers can assess the relationship between UCP1 and ROS by:

  • Comparing ROS production in wild-type versus UCP1-knockout BAT mitochondria using fluorescent probes

  • Examining the effects of ROS scavengers on mitochondrial function in UCP1-deficient models

  • Measuring the sensitivity to mitochondrial permeability transition in response to calcium loading

What are the physiological consequences of UCP1 deficiency in brown adipose tissue?

UCP1 deficiency leads to profound alterations in brown adipose tissue beyond the simple loss of thermogenic capacity. Studies of UCP1-knockout mice reveal multiple physiological consequences:

  • Reduced electron transport chain (ETC) abundance: Proteomic analysis shows dramatic reduction in ETC component expression following cold exposure in UCP1-deficient BAT

  • Mitochondrial calcium handling defects: UCP1-KO BAT mitochondria exhibit reduced calcium buffering capacity and increased sensitivity to calcium overload-induced dysfunction

  • Activation of innate immune signaling: Cold exposure in UCP1-KO mice triggers innate immune responses and markers of cell death in BAT

  • Increased susceptibility to ROS-mediated damage: UCP1-deficient mitochondria are highly vulnerable to ROS-induced mitochondrial permeability transition

  • Compromised cold-induced respiratory response: The maximal chemically uncoupled oxygen consumption (an UCP1-independent parameter) is lower in UCP1-KO adipocytes compared to wild-type

What methodological considerations are important when expressing recombinant canine UCP1 for structural and functional studies?

When expressing recombinant canine UCP1 for research purposes, several methodological considerations are critical for successful experiments:

  • Expression System Selection:

    • Mammalian expression systems (e.g., HEK293, COS cells) provide proper post-translational modifications but may have lower yield

    • Yeast systems (S. cerevisiae) offer higher expression levels but may lack mammalian-specific modifications

    • Bacterial systems provide high yield but often struggle with proper folding of membrane proteins like UCP1

  • Protein Targeting and Insertion:

    • Include the native mitochondrial targeting sequence to ensure proper localization

    • Alternatively, use a heterologous targeting sequence with confirmed efficacy in the chosen expression system

    • Monitor mitochondrial insertion efficiency using fractionation and Western blotting techniques

  • Functional Validation Approaches:

    • Patch-clamp electrophysiology of isolated mitochondria or reconstituted proteoliposomes

    • Proton leak kinetics measurement using oxygen consumption and membrane potential

    • Thermal imaging of cells expressing UCP1 versus controls

    • Measurement of fatty acid-induced uncoupling using respiratory analysis

  • Common Technical Challenges and Solutions:

ChallengeSolutionMethodological Approach
Low expression levelsCodon optimizationAdjust codons to match expression system preference
Protein aggregationDetergent screeningTest multiple detergents for solubilization efficiency
Impaired functionLipid environment optimizationReconstitute in lipids mimicking mitochondrial composition
DegradationProtease inhibitorsInclude specific inhibitors during purification

Successful recombinant expression has been confirmed using Western blotting, functional assays in yeasts or mammalian cells, and through measurement of proton conductance in reconstituted systems .

How does the molecular pathophysiology of UCP1 deficiency extend beyond thermogenesis to mitochondrial proteostasis?

The molecular consequences of UCP1 deficiency extend far beyond the loss of thermogenic capacity, revealing a critical role for UCP1 in maintaining mitochondrial proteostasis and function:

  • Discordance between mRNA and protein levels: In UCP1-knockout BAT, there is a striking reduction in ETC protein abundance that is not matched by corresponding reductions in mRNA levels, suggesting post-transcriptional regulation

  • Mitochondrial stress response activation: UCP1 deficiency triggers cellular stress pathways including inflammation and innate immune signaling in brown adipocytes following cold exposure

  • Calcium homeostasis disruption: UCP1-KO mitochondria exhibit impaired calcium buffering capacity, making them vulnerable to calcium overload-induced dysfunction

  • ROS-dependent pathology mechanism: The dysfunction in UCP1-deficient mitochondria depends specifically on ROS production by reverse electron transport through mitochondrial complex I, as it can be rescued by:

    • Inhibition of electron transfer through complex I

    • Pharmacologic depletion of ROS levels

  • Potential experimental approaches to study these mechanisms:

    • Pulse-chase experiments to examine protein synthesis and degradation rates

    • Proteomic analysis comparing wild-type and UCP1-KO mitochondria under various conditions

    • Assessment of mitochondrial unfolded protein response activation

    • Measurement of mitochondrial translation efficiency

These findings suggest that UCP1-KO animals may serve as a model for studying fundamental mechanisms of mitochondrial proteostasis beyond their traditional use in thermogenesis research .

What distinguishes UCP1-dependent and UCP1-independent uncoupling mechanisms in adipose tissue?

Research has revealed that uncoupling in adipose tissue can occur through both UCP1-dependent and UCP1-independent mechanisms, with important distinctions:

UCP1-Dependent Uncoupling:

  • Requires the physical presence of UCP1 protein in the inner mitochondrial membrane

  • Is directly activated by fatty acids released during lipolysis

  • Can be inhibited by purine nucleotides (GDP, ATP)

  • Predominates in classical brown adipocytes

  • Is rapidly activated in response to sympathetic stimulation

UCP1-Independent Uncoupling:

  • Occurs in beige/brite adipocytes without requiring UCP1 expression

  • May involve alternative uncoupling proteins or mechanisms

  • Has been demonstrated in human white fat-derived beige adipocytes

  • Produces similar metabolic effects but through distinct molecular pathways

  • The precise mechanisms remain incompletely characterized

Recent systems biology analyses have demonstrated that uncoupling capability of human beige adipocytes can be obtained without UCP1 activity . These findings challenge the traditional view that UCP1 is absolutely required for adaptive thermogenesis in all thermogenic adipocytes.

Methodologically, researchers can distinguish between these mechanisms by:

  • Using UCP1-knockout models to identify residual uncoupling activity

  • Applying specific inhibitors of various mitochondrial carriers

  • Performing comprehensive proteomic analysis to identify alternative uncoupling mediators

  • Measuring respiration in the presence and absence of fatty acids or purine nucleotides

  • Examining the time course of activation following adrenergic stimulation

How does UCP1 function in canines relate to therapeutic applications for metabolic disorders?

The study of canine UCP1 has implications for therapeutic strategies targeting metabolic disorders in both veterinary and potentially human medicine:

  • Comparative metabolic physiology: Dogs represent an important model organism with distinct metabolic characteristics compared to rodents, potentially offering insights into human metabolism

  • Therapeutic target identification: Understanding UCP1 regulation in dogs can reveal conserved pathways that might be targeted pharmacologically to enhance energy expenditure

  • Methodological approaches to therapeutic development:

    • Small molecule screening for UCP1 activators using canine recombinant UCP1

    • Testing of compounds that increase UCP1 expression in canine adipocytes

    • Development of adipose tissue-specific drug delivery systems

    • Identification of browning agents that promote UCP1 expression in white adipose depots

  • Potential applications in canine health:

    • Management of canine obesity through UCP1 activation

    • Treatment of metabolic disorders common in certain dog breeds

    • Age-related metabolic decline intervention

  • Translational considerations:

    • Species differences in UCP1 regulation and brown fat distribution

    • Variation in drug metabolism between canines and humans

    • Ethical considerations in therapeutic development

By studying UCP1 in canines, researchers can gain valuable insights into the mechanisms of energy expenditure and develop potential therapeutic approaches for metabolic conditions . The Dog Mitochondrial Brown Fat UCP1 ELISA Kit provides a valuable tool for these studies, enabling accurate and quantitative analysis of UCP1 levels in research investigating canine metabolism and energy regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.