Recombinant Dog Mitochondrial cardiolipin hydrolase (PLD6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dog Mitochondrial Cardiolipin Hydrolase (PLD6)

Recombinant dog mitochondrial cardiolipin hydrolase, also known as PLD6, is a phospholipase D enzyme primarily localized to the outer mitochondrial membrane. It plays a crucial role in mitochondrial dynamics by facilitating the generation of phosphatidic acid (PA) from cardiolipin or other phospholipids, although its cardiolipin hydrolase activity is debated due to its localization and substrate specificity issues . Despite this, PLD6 is recognized for its involvement in mitochondrial fusion and regulation of mitochondrial morphology .

Function and Mechanism of PLD6

PLD6 is involved in the hydrolysis of phospholipids to produce phosphatidic acid, which acts as a signaling lipid promoting mitochondrial clustering and fusion. This process is critical for maintaining mitochondrial function and quality control . The generation of PA by PLD6 can inhibit mitochondrial fission by affecting the activity of Drp1, a key protein in mitochondrial division .

Interaction with Other Proteins

PLD6 interacts with proteins like NME3, which binds to phosphatidic acid and mediates PLD6-induced mitochondrial tethering. This interaction is essential for the selective fusion of mitochondria, ensuring mitochondrial quality . Additionally, glycerol kinase-like proteins (Gykl1 and Gk2) cooperate with PLD6 to induce mitochondrial clustering, highlighting the complex regulatory network involving PLD6 .

Biological Implications

  • Spermiogenesis: PLD6 plays a role in spermiogenesis, particularly in regulating mitochondrial sheath formation and ATP production in spermatozoa .

  • piRNA Biogenesis: PLD6 has been implicated in the biogenesis of piRNAs, which are crucial for silencing transposons in germline cells .

Recombinant PLD6 Production and Characteristics

Recombinant PLD6 proteins are produced in various hosts, including E. coli, yeast, and mammalian cells. These proteins are often tagged for purification and detection purposes. The recombinant form of PLD6 can be used in research to study its enzymatic activity, interactions with other proteins, and its role in mitochondrial dynamics .

Recombinant dog mitochondrial cardiolipin hydrolase (PLD6) is a valuable tool for studying mitochondrial dynamics and the regulation of phospholipid metabolism. Its role in generating phosphatidic acid and facilitating mitochondrial fusion highlights its importance in cellular processes. Further research on PLD6 will continue to elucidate its functions and potential applications in biotechnology and medicine.

References NME3 binds to phosphatidic acid and mediates PLD6-induced mitochondrial fusion. Mitochondrial cardiolipin hydrolase (PLD6) Recombinant Protein. Glycerol kinase-like proteins cooperate with Pld6 in regulating mitochondrial dynamics. PLD6 dimer hydrolyses cardiolipin to PA and PG - Reactome. Pld6 phospholipase D family member 6 [Mus musculus]. The role of cardiolipin as an acyl donor in dog heart. Roles of MIWI, MILI and PLD6 in small RNA regulation in mouse. pld6 - Mitochondrial cardiolipin hydrolase | UniProtKB.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
PLD6; Mitochondrial cardiolipin hydrolase; Choline phosphatase 6; Mitochondrial phospholipase; MitoPLD; Phosphatidylcholine-hydrolyzing phospholipase D6; Phospholipase D6; PLD 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
PLD6
Target Protein Sequence
MERFRWQVAAVAAVGLALALEALPSVLCWLRAGRRQQQRPPRRQVLFFPSQVTCTEALLQAPGEAPSGPPAGCRCSLPHGESSLSRLLRALLAARASLELCLFAFSSPQLGRAVQLLHQRGVRVRVITDCDYMALNGSQIGLLRKAGIQVRHDQDLGYMHHKFAIVDKKVLITGSLNWTTQAIQNNRENVLIMEDEEYVRLFLEEFERIWEEFNPTKYTFFPQKKTGTSLPPQVSCFGQLVSCHSKCSHHLSQV
Uniprot No.

Target Background

Function
Recombinant Dog Mitochondrial cardiolipin hydrolase (PLD6) exhibits phospholipase and nuclease activities, contingent upon varying physiological conditions. Interaction with Mitoguardin (MIGA1 or MIGA2) affects the dimer conformation, promoting lipase activity over nuclease activity. It plays a crucial role in mitochondrial fusion and fission through its phospholipase activity. Acting as a phospholipase, it utilizes mitochondrial cardiolipin as a substrate to generate phosphatidate (PA or 1,2-diacyl-sn-glycero-3-phosphate), a second messenger signaling lipid. Production of PA facilitates Mitofusin-mediated fusion, while Lipin family phosphatases cleave PA to produce diacylglycerol (DAG), promoting mitochondrial fission. Both Lipin and DAG regulate mitochondrial dynamics and membrane fusion/fission, essential processes for adapting mitochondrial metabolism to cellular physiological changes. Mitochondrial fusion enables cells to manage the increased nucleotide demand during DNA synthesis. Mitochondrial function and dynamics are intricately linked to biological processes such as cell growth, proliferation, and differentiation. As a mediator of MYC activity, it promotes mitochondrial fusion and activates AMPK, which in turn inhibits YAP/TAZ, ultimately inducing cell growth and proliferation. The endonuclease activity plays a critical role in PIWI-interacting RNA (piRNA) biogenesis during spermatogenesis. Implicated in spermatogenesis and sperm fertility within testicular germ cells, its single strand-specific nuclease activity is essential for the biogenesis/maturation of PIWI-interacting RNA (piRNA). MOV10L1 selectively binds to piRNA precursors and directs them to the endonuclease, which catalyzes the initial cleavage step in piRNA processing, generating piRNA intermediate fragments that are subsequently loaded onto Piwi proteins. It cleaves both DNA and RNA substrates with comparable affinity, producing a 5' phosphate end, thereby participating in the processing of primary piRNA transcripts. piRNAs provide crucial protection against the activity of mobile genetic elements. piRNA-mediated transposon silencing is thus vital for maintaining genome stability, particularly in germline cells where transposons are mobilized due to widespread genomic demethylation. PA may act as a signaling molecule in the recognition/transport of precursor RNAs for primary piRNAs. It interacts with tesmin in testes, suggesting a role in spermatogenesis through its association with its interacting partner.
Database Links
Protein Families
Phospholipase D family, MitoPLD/Zucchini subfamily
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane. Cell membrane. Golgi apparatus.

Q&A

What is Mitochondrial Cardiolipin Hydrolase (PLD6) and what are its primary functions?

Mitochondrial Cardiolipin Hydrolase, also known as PLD6, is the sixth member of the phospholipase D family that exhibits dual functionality as both a phospholipase and a nuclease depending on physiological conditions. In its phospholipase role, PLD6 uses mitochondrial cardiolipin as a substrate to generate phosphatidate (PA), a signaling lipid that facilitates Mitofusin-mediated fusion of mitochondria . The protein plays a key role in regulating mitochondrial dynamics, particularly the processes of fusion and fission, which are critical for adapting mitochondrial metabolism to changes in cellular physiology . Additionally, PLD6 functions as an endonuclease involved in the production of primary piwi-interacting RNA (piRNA), which regulates male germ cell development and maintains genome stability . The activity of PLD6 can be modulated by its interaction with proteins such as Mitoguardin (MIGA1 or MIGA2), which affects its dimer conformation and facilitates lipase activity over nuclease activity . These diverse functions position PLD6 as an important player in cellular processes including mitochondrial function, reproductive biology, and genome protection.

What is the subcellular localization of PLD6 and how does this relate to its function?

PLD6 is primarily localized to the outer mitochondrial membrane, which directly supports its role in mitochondrial dynamics and lipid metabolism . Specifically, the Val10-Val32 sequence has been identified as a transmembrane segment through TMHMM 2.0 analysis, allowing the protein to anchor firmly in the mitochondrial membrane . This strategic localization enables PLD6 to access its substrate cardiolipin, which is abundant in mitochondrial membranes, and to generate phosphatidic acid (PA) directly at sites where it can influence mitochondrial morphology . The membrane positioning also facilitates interactions with other mitochondrial proteins involved in fusion and fission processes, including Mitofusins . Interestingly, despite being primarily characterized as a mitochondrial protein, PLD6 also participates in nuclear processes through its role in piRNA biogenesis, suggesting that it may either shuttle between compartments or influence nuclear events through downstream signaling pathways . This dual localization pattern highlights how subcellular positioning is intricately linked to the multifunctional nature of PLD6, enabling it to coordinate processes across different cellular compartments. Researchers should consider this compartmentalization when designing experiments to study PLD6 functions in isolation.

What are the conserved domains and key structural features of PLD6?

PLD6 contains several highly conserved regions that are critical to its enzymatic functions as both a phospholipase and a nuclease. Sequence analysis has identified four particularly conserved motifs: Val41-Ser46 (VLFFPS), Glu91-Ser99 (ELCLFAFSS), Met151-Ala156 (MHHKFA), and Leu163-Trp170 (LITGSLNW) . These conserved regions likely contribute to substrate binding, catalytic activity, or structural stability of the protein. Most of the conserved amino acids are located on the protein surface, suggesting their involvement in functional interactions with substrates or binding partners . Bioinformatic analyses have shown that PLD6 is a highly conserved protein with significant homology to the mouse Q5SWZ9 protein, indicating evolutionary preservation of its important biological functions . The protein contains a transmembrane segment (Val10-Val32) that anchors it to the outer mitochondrial membrane, positioning the catalytic domains appropriately for interaction with membrane lipids . Molecular dynamics simulations have demonstrated the binding of PLD6 to cardiolipin (CL), forming a stable PLD6-CL complex that supports its phospholipase activity . Understanding these structural features is essential for researchers studying structure-function relationships or designing experiments to modulate PLD6 activity in experimental systems.

What expression systems are optimal for producing recombinant dog PLD6 protein?

Several expression systems have been successfully employed for producing recombinant dog PLD6, each with distinct advantages depending on research objectives. Yeast-based expression systems have demonstrated effectiveness for producing dog PLD6 (AA 33-254) with His tag, offering a eukaryotic environment that facilitates proper protein folding while maintaining relatively high yields . For researchers requiring higher purity and mammalian post-translational modifications, HEK-293 cell expression systems have successfully generated recombinant PLD6 with greater than 90% purity as determined by Bis-Tris PAGE, anti-tag ELISA, Western Blot, and analytical SEC (HPLC) . Baculovirus expression systems represent another viable option, particularly when larger quantities of protein are needed while maintaining eukaryotic processing capabilities, achieving purities of >85% as demonstrated by SDS-PAGE analysis . For rapid screening applications, cell-free protein synthesis (CFPS) systems have produced recombinant PLD6 with Strep Tag at 70-80% purity, suitable for preliminary studies . When selecting an expression system, researchers should consider the downstream applications—structural studies or enzymatic assays may require higher purity preparations from HEK-293 or baculovirus systems, while screening experiments might benefit from the speed and flexibility of cell-free synthesis. Each system offers a different balance of yield, purity, post-translational modifications, and scalability that should be evaluated against specific research requirements.

What are the recommended methods for purifying recombinant PLD6 while maintaining its dual enzymatic activities?

Purification of recombinant PLD6 requires careful consideration to preserve both its phospholipase and nuclease activities. Affinity chromatography using the appropriate tag system represents the initial purification step, with His-tagged PLD6 variants being effectively purified through immobilized metal affinity chromatography (IMAC) under gentle elution conditions to prevent protein denaturation . Following affinity purification, size exclusion chromatography (SEC) has proven valuable for achieving higher purity levels (>90%) while simultaneously confirming the protein's quaternary structure, as analytical SEC is commonly used to verify recombinant PLD6 quality . When purifying PLD6, researchers should maintain a pH range of 7.0-8.0 and include glycerol (5-50%) in the final formulation to stabilize protein structure and prevent aggregation during storage . The addition of reducing agents such as dithiothreitol (DTT) or β-mercaptoethanol at low concentrations can help maintain critical cysteine residues in their reduced state, preserving enzymatic activity. Verification of dual enzymatic activities post-purification is essential, with phospholipase activity assessable through cardiolipin hydrolysis assays and nuclease function verifiable through nucleic acid cleavage assays . Minimizing freeze-thaw cycles is critical, as repeated freezing and thawing significantly impairs protein function—working aliquots should be stored at 4°C for up to one week, while long-term storage requires -20°C/-80°C with appropriate cryoprotectants .

What assays are recommended for measuring PLD6 phospholipase activity using cardiolipin as a substrate?

Measuring PLD6 phospholipase activity with cardiolipin requires specialized assays that account for the unique properties of this mitochondrial lipid substrate. A robust approach involves fluorescent or radiolabeled cardiolipin substrates to directly monitor the production of phosphatidic acid (PA), the primary product of PLD6-mediated cardiolipin hydrolysis . Molecular dynamics simulation studies have confirmed the stable binding between PLD6 and cardiolipin, providing a theoretical foundation for designing experimental conditions that optimize enzyme-substrate interactions . When developing these assays, incorporating physiologically relevant concentrations of Mg²⁺ or Ca²⁺ ions is critical as these divalent cations typically modulate phospholipase activity . For more sensitive detection of enzymatic activity, mass spectrometry-based lipidomics offers precise quantification of both substrate depletion and product formation, allowing researchers to calculate enzyme kinetics parameters such as Km and Vmax under varying conditions . Alternative approaches include coupled enzyme assays where PA production is linked to a secondary reaction with colorimetric or fluorometric readouts, simplifying detection in high-throughput formats. Researchers should validate their assays using known phospholipase inhibitors or catalytically inactive PLD6 mutants as negative controls to confirm specificity . When interpreting results, it's important to distinguish PLD6's phospholipase activity from its nuclease function by carefully selecting reaction conditions and substrates that favor lipid hydrolysis over nucleic acid cleavage.

How does PLD6 coordinate its dual functions as both a phospholipase and a nuclease in different cellular contexts?

PLD6 exhibits a remarkable functional duality that is tightly regulated through protein-protein interactions and cellular context. Research indicates that the interaction with Mitoguardin proteins (MIGA1 or MIGA2) specifically shifts the conformational equilibrium of PLD6 dimers to favor phospholipase activity over nuclease function . This conformational switching mechanism allows cells to spatiotemporally control which enzymatic activity predominates in response to changing physiological conditions . Within mitochondria, the lipid microenvironment appears to promote PLD6's phospholipase activity, generating phosphatidic acid that serves as a critical signaling molecule for mitochondrial fusion events . Conversely, in the context of piRNA biogenesis, PLD6 functions primarily as an endonuclease, suggesting that cellular compartmentalization and specific binding partners in this pathway redirect its enzymatic preference . Protein interaction network analyses have revealed significant relationships between PLD6 and piRNA binding proteins, providing molecular context for its nuclease function . This functional switching likely involves subtle conformational changes in the active site that alter substrate preference between phospholipids and nucleic acids. Expression studies in reproductive tissues have shown that PLD6 expression patterns correlate with spermatogonium-related genes, suggesting developmental regulation of its dual activities during gametogenesis . Understanding the molecular mechanisms governing this functional duality represents a significant challenge for researchers, requiring sophisticated approaches like cross-linking mass spectrometry or hydrogen-deuterium exchange to capture conformational states associated with each enzymatic activity.

What role does PLD6 play in mitochondrial dynamics and how does this impact cellular metabolism?

PLD6 serves as a critical regulator of mitochondrial dynamics through its phospholipase activity, which directly impacts cellular energy metabolism and adaptation to physiological demands. By catalyzing the conversion of cardiolipin to phosphatidic acid (PA), PLD6 generates a signaling lipid that facilitates Mitofusin-mediated fusion events between mitochondria . This fusion process enables mitochondrial networks to respond to increased metabolic demands, particularly during DNA synthesis when nucleotide requirements are elevated . Concurrently, the downstream conversion of PA to diacylglycerol (DAG) by Lipin family phosphatases promotes mitochondrial fission, creating a balanced cycle of fusion and division essential for mitochondrial quality control . The regulation of mitochondrial morphology directly influences the efficiency of oxidative phosphorylation, as more interconnected networks typically demonstrate enhanced ATP production capacity. Studies suggest that PLD6-mediated lipid signaling integrates with cellular pathways governing growth, proliferation, and differentiation—processes with substantial energy requirements that necessitate mitochondrial adaptation . In highly metabolically active tissues, PLD6 activity likely fluctuates in response to energy demands, coordinating mitochondrial morphology with substrate availability and utilization. The enzyme's localization to the outer mitochondrial membrane positions it ideally to sense changes in the cellular environment and translate these into modifications of mitochondrial architecture through lipid intermediates . Future research investigating how post-translational modifications of PLD6 respond to metabolic signals could reveal additional regulatory mechanisms connecting mitochondrial dynamics to cellular metabolism under various physiological and pathological conditions.

How is PLD6 involved in piRNA biogenesis and what are the implications for reproductive biology?

PLD6 plays a fundamental role in primary piRNA biogenesis through its endonuclease activity, with profound implications for reproductive biology, particularly in male gamete development. Studies have established that PLD6 functions as a nucleic acid endonuclease that is essential for the initial processing steps in piRNA production, creating the 5' ends of primary piRNAs that subsequently associate with PIWI proteins . This piRNA generation process is critically important for silencing transposable elements in the germline, preventing genomic instability that could compromise germ cell integrity and function . Expression analysis of bovine testes revealed that PLD6 levels significantly increase during sexual maturation, with two-year-old Simmental calves showing markedly higher expression compared to six-month-old calves, suggesting developmental regulation corresponding to reproductive maturation . Immunofluorescent staining has verified the expression of PLD6 protein in bovine spermatogenic cells in patterns similar to the germ cell marker DEAD box helicase 4 (DDX4, also known as VASA), further supporting its role in germline development . Bioinformatic analyses have identified significant relationships between PLD6 and piRNA binding proteins, forming a functional network essential for piRNA-mediated genome protection . The expression pattern of PLD6 in testes resembles that of spermatogonium-related genes, indicating its involvement in early stages of spermatogenesis . Developmental analysis has shown that PLD6 transcription is relatively low during embryonic development but increases at E15.5-E16.5, coinciding with critical periods of reproductive system formation . These findings collectively demonstrate that PLD6's nuclease function is integral to reproductive development through its role in maintaining germline genome stability via the piRNA pathway.

What are common challenges in working with recombinant PLD6 and how can they be addressed?

Researchers working with recombinant PLD6 frequently encounter several technical challenges that can be systematically addressed with appropriate strategies. Protein solubility issues often arise during expression and purification, as the transmembrane segment (Val10-Val32) can promote aggregation . This challenge can be mitigated by expressing truncated constructs that exclude the transmembrane domain or by using specialized detergents like digitonin or CHAPS during purification to maintain native-like membrane protein folding . Another common difficulty is maintaining dual enzymatic activity during storage, as both phospholipase and nuclease functions can deteriorate at different rates. Implementing a storage protocol with 5-50% glycerol at -20°C/-80°C while strictly avoiding repeated freeze-thaw cycles preserves functional integrity . Researchers may also encounter inconsistent activity measurements due to the dual functionality of PLD6, which can be addressed by carefully optimizing reaction conditions to favor either phospholipase or nuclease activity depending on the experimental objectives . Tag interference with enzymatic activity represents another potential issue, particularly for smaller proteins like PLD6 where bulky tags may distort active site geometry. Testing multiple tag positions (N-terminal versus C-terminal) or using cleavable tag systems can help identify configurations that minimize functional interference . Expression system selection can significantly impact post-translational modifications and folding, with HEK-293 cells or baculovirus systems generally providing superior results for functional studies compared to prokaryotic systems . Finally, inconsistent yield and purity issues can be addressed through careful optimization of expression conditions, including induction timing, temperature, and duration, followed by multi-step purification protocols combining affinity chromatography with size exclusion or ion exchange methods .

How can researchers distinguish between the phospholipase and nuclease activities of PLD6 in experimental settings?

Distinguishing between the dual enzymatic activities of PLD6 requires carefully designed experimental approaches that selectively measure each function. Researchers can employ substrate-specific assays where phospholipase activity is evaluated using purified cardiolipin substrates while monitoring phosphatidic acid (PA) production through thin-layer chromatography, mass spectrometry, or coupled enzyme systems . Conversely, nuclease activity can be assessed using synthetic RNA oligonucleotides that mimic pre-piRNA structures, with cleavage products analyzed by gel electrophoresis or fluorescence-based detection methods . Buffer composition provides another powerful tool for functional differentiation—phospholipase activity typically requires divalent cations like Mg²⁺, while specific pH conditions and metal cofactors can selectively enhance one activity over the other . Selective inhibitors offer an additional approach, as compounds targeting phospholipase activity (such as D609 or CAY10594) often have limited effects on nuclease function and vice versa, allowing researchers to pharmacologically isolate each activity . Protein engineering strategies, including site-directed mutagenesis of catalytic residues specific to either phospholipase or nuclease function, can generate valuable tools for distinguishing between these activities in cellular contexts . Interaction with binding partners like Mitoguardin (MIGA1 or MIGA2) has been shown to favor phospholipase activity, providing another experimental variable that can be manipulated to emphasize one function over the other . The subcellular localization of PLD6 activity can also serve as an indicator, with mitochondrial-associated functions typically reflecting phospholipase activity while nuclease function may be observed in different cellular compartments associated with piRNA processing . By systematically applying these approaches, researchers can effectively isolate and study the distinct enzymatic functions of this multifunctional protein.

What experimental controls are essential when studying PLD6 functions in vitro and in cellular systems?

Rigorous experimental controls are crucial for obtaining reliable and interpretable data when investigating PLD6 functions across different experimental systems. When conducting in vitro enzymatic assays, heat-inactivated PLD6 serves as an essential negative control to distinguish enzyme-specific activity from spontaneous substrate degradation or contaminating enzymatic activities . Catalytically inactive mutants, generated through site-directed mutagenesis of key residues in either the phospholipase or nuclease active sites, provide more specific negative controls while maintaining protein structure and potential binding interactions . For phospholipase activity assays, including phospholipase inhibitors as pharmacological controls helps confirm the specificity of observed activities . When working with recombinant proteins, tag-only controls (expressing and purifying just the affinity tag portion) are essential to rule out tag-mediated effects on observed activities or interactions . In cellular systems, RNA interference (RNAi) or CRISPR-Cas9 mediated knockdown/knockout of endogenous PLD6 creates crucial baseline conditions for rescue experiments with recombinant variants . Subcellular localization studies should include co-staining with established mitochondrial markers to confirm proper targeting of PLD6 constructs to the outer mitochondrial membrane . For mitochondrial dynamics studies, selective inhibitors of fusion (such as Mdivi-1) or fission can help delineate PLD6's specific contributions to these processes . Time-course experiments are valuable for documenting the sequential effects of PLD6 activity, particularly for processes like piRNA biogenesis or mitochondrial morphology changes that occur in stages . Species-matched controls are important when studying dog PLD6, as despite high conservation, species-specific differences in protein interactions or regulation may exist . These comprehensive controls ensure that experimental observations can be confidently attributed to specific PLD6 functions rather than experimental artifacts or secondary effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.