Recombinant Dog Mitochondrial uncoupling protein 2 (UCP2)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Mechanisms

UCP2 plays critical roles in mitochondrial and cellular homeostasis:

  • Uncoupling Activity: Dissipates the proton gradient, reducing ATP synthesis while mitigating oxidative stress .

  • ROS Regulation: Limits mitochondrial ROS production by lowering membrane potential, protecting against oxidative damage .

  • Metabolic Modulation: Influences fatty acid oxidation, glycolysis, and calcium homeostasis .

In dog-specific studies, UCP2 polymorphisms have been linked to metabolic traits, though recombinant forms enable controlled experimentation . Overexpression in cardiomyocytes reduces ROS and prevents mitochondrial calcium overload, highlighting its cardioprotective potential .

Experimental Uses

  • In Vitro Studies: Used to investigate mitochondrial dysfunction in metabolic diseases (e.g., obesity, diabetes) .

  • Therapeutic Development: Tested in gene therapy models to counteract oxidative stress in cardiovascular and neurodegenerative disorders .

  • Biomarker Analysis: Quantified in dog serum/plasma using ELISA (e.g., Assay Genie Kit CNEB0327) .

Key Findings

Study FocusOutcomeSource
Cardiomyocyte ProtectionUCP2 overexpression reduced H<sub>2</sub>O<sub>2</sub>-induced apoptosis by 60%
Metabolic RegulationLinked to fatty acid oxidation and glucose homeostasis in dog models
ROS ScavengingReduced mitochondrial ROS by 40% in endothelial cells

Usage Guidelines

  • Reconstitution: Solubilize in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

  • Assay Compatibility: Compatible with mitochondrial respiration assays, Western blotting, and ELISA .

  • Limitations: Overexpression may disrupt calcium handling or energy metabolism in non-physiological contexts .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage state, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is recommended to prevent repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
UCP2; SLC25A8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGERQGPVRAAASAQYR GVLCTILTMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGSGRRYQSTVDAYKTIAREEGFRGLWKGTS PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA ACTSREAPF
Uniprot No.

Target Background

Function
UCPs are mitochondrial transporter proteins responsible for creating proton leaks across the inner mitochondrial membrane, thereby uncoupling oxidative phosphorylation from ATP synthesis. Consequently, energy is dissipated as heat.
Gene References Into Functions
  1. UCP2 protein and mRNA levels were negatively correlated with myocardial energy levels in a model of endotoxic shock PMID: 25526378
Database Links

KEGG: cfa:403576

STRING: 9615.ENSCAFP00000008312

UniGene: Cfa.93

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What genetic polymorphisms have been identified in canine UCP2?

DNA sequence analysis across 11 different dog breeds (n=119) identified 10 SNPs (9 intronic and 1 exonic) and 4 indels (all intronic) in the canine UCP2 gene . These polymorphisms represent natural genetic variation that may influence UCP2 expression and function. The exonic SNP may directly affect protein structure or function, while intronic variants could influence splicing efficiency or gene expression levels .

How does canine UCP2 compare with UCP2 from other species?

Phylogenetic analysis shows that canine UCP2 clusters closely with other mammalian UCP2 orthologs. Dog UCP2 shows approximately 78% amino acid similarity with human, rat, and mouse UCP2 . Fish and amphibian UCP2 proteins form a distinct cluster from mammalian UCP2 with high bootstrap support (87%) . The high degree of conservation across species suggests fundamental physiological importance of this protein.

What are the methodological considerations for working with recombinant canine UCP2 protein?

When working with recombinant canine UCP2:

  • Storage and handling: Store lyophilized protein at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can compromise protein integrity .

  • Reconstitution protocol: The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% is recommended for long-term storage at -20°C/-80°C .

  • Functional assays: When measuring UCP2 activity, the choice of substrate and experimental conditions is critical. Since UCP2 requires specific activators like superoxide or fatty acids for measurable proton transport, assays should include appropriate activators to observe physiological activity .

  • Biological validation: Expression systems may favor artifacts leading to nonspecific uncoupling of mitochondria. Therefore, validation in canine cells/tissues is essential to confirm physiological relevance of recombinant protein function .

How can researchers address the controversy surrounding UCP2's primary function in dogs?

Despite structural classification as an uncoupling protein, UCP2's precise physiological role remains debated among researchers. To address this controversy:

  • Multiple functional assays: Employ complementary approaches that measure:

    • Proton conductance (patch clamp or proton flux assays)

    • ROS production (fluorescent probes like MitoSOX or CM-H2DCFDA)

    • Mitochondrial membrane potential (JC-1 or TMRM dyes)

    • ATP production (luciferase-based assays)

  • Tissue-specific analyses: Examine UCP2 function in different canine tissues since its role may vary between organs. Studies in humans and rodents show differential effects in pancreatic β-cells compared to heart or immune cells .

  • Genetic models: When possible, utilize gene silencing or overexpression approaches in canine cell lines to manipulate UCP2 levels and measure resulting phenotypes .

  • Control experiments: Include UCP1 (a confirmed uncoupler) as a positive control and UCP2 inhibitors like GDP to confirm specificity of observed effects .

How do specific polymorphisms in canine UCP2 correlate with metabolic parameters?

Research examining associations between UCP2 polymorphisms and metabolic parameters in Labrador Retrievers (n=50) found no significant associations between UCP2 variants and levels of glucose, total cholesterol, lactate dehydrogenase, or triglycerides . This contrasts with findings in humans, where UCP2 polymorphisms have been linked to obesity, insulin resistance, and type 2 diabetes .

For future association studies:

  • Larger sample sizes: Initial studies with 50 dogs may have lacked statistical power. Researchers should aim for larger cohorts.

  • Breed diversity: Extend studies beyond Labrador Retrievers to account for breed-specific genetic backgrounds.

  • Additional parameters: Consider measuring mitochondrial function directly (oxygen consumption, ROS production) alongside standard metabolic markers.

  • Environmental factors: Control for diet, exercise, and other environmental variables that may mask genetic associations .

What is the relationship between canine UCP2 and reactive oxygen species (ROS) management?

UCP2 is widely accepted to attenuate steady-state levels of ROS through dissipation of mitochondrial protonmotive force . For researchers studying this relationship in dogs:

  • Methodological approach: Measure mitochondrial ROS production using:

    • MitoSOX for superoxide detection

    • DCF-based probes for hydrogen peroxide

    • EPR spectroscopy for direct radical detection

  • Experimental design considerations:

    • Compare ROS production in mitochondria with normal versus altered UCP2 expression

    • Use specific activators (superoxide, lipid peroxidation products) to stimulate UCP2

    • Employ inhibitors like GDP to confirm UCP2-specific effects

    • Monitor membrane potential simultaneously to correlate with ROS production

  • Physiological context: Consider that UCP2 may respond to, rather than primarily prevent, oxidative stress. Some evidence suggests that superoxide and downstream lipid peroxidation products activate UCP2, creating a negative feedback loop .

How might canine UCP2 function differ in various pathophysiological states?

Based on studies in humans and rodents, UCP2 function may vary significantly in disease states:

  • Diabetes/obesity: In metabolic disorders, UCP2 may influence:

    • Glucose sensing and insulin secretion in pancreatic β-cells

    • Fatty acid metabolism adaptation

    • Protection against lipotoxicity

  • Cardiovascular disease: UCP2 upregulation appears protective in cardiac tissue, potentially:

    • Postponing pathological changes in cardiomyopathy

    • Allowing better utilization of fatty acid oxidation

    • Preventing systemic lactic acidosis

  • Experimental approaches:

    • Compare UCP2 expression and function in tissues from healthy versus diseased dogs

    • Examine tissue-specific effects in multiple organ systems

    • Consider the impact of disease duration on UCP2 adaptation

    • Analyze UCP2 post-translational modifications that may differ in disease states

What is the relationship between canine UCP2 and UCP3 in metabolic regulation?

UCP2 and UCP3 are closely related paralogs with 78-93% sequence similarity that may have complementary functions:

  • Genomic organization: The genes encoding UCP2 and UCP3 are adjacent in all species studied, suggesting potential co-regulation or complementary functions .

  • Expression patterns: While UCP2 is expressed in multiple tissues (kidney, pancreas, spleen, immune cells, CNS), UCP3 expression is more restricted to muscle and adipose tissue .

  • Experimental approaches to distinguish roles:

    • Compare tissue-specific expression patterns in dogs

    • Examine correlation between polymorphisms in both genes and metabolic parameters

    • Use selective gene silencing to determine individual versus compensatory roles

    • Analyze protein-protein interactions between UCP2, UCP3 and other mitochondrial proteins

What are the optimal expression systems for producing functional recombinant canine UCP2?

The choice of expression system significantly impacts the quality and functionality of recombinant UCP2:

  • Bacterial expression systems: E. coli is commonly used for producing recombinant canine UCP2 with N-terminal His tags . This system:

    • Provides high protein yields

    • May lack post-translational modifications present in native UCP2

    • Requires refolding protocols to ensure proper membrane protein structure

  • Eukaryotic alternatives:

    • Yeast systems (Pichia pastoris, Saccharomyces cerevisiae) may provide better membrane protein folding

    • Insect cell systems can accommodate complex membrane proteins

    • Mammalian cell lines (preferably canine) would provide the most native-like modifications

  • Reconstitution strategies:

    • Liposome reconstitution is crucial for functional studies

    • Nanodiscs may provide a more stable membrane environment

    • Direct incorporation into mitochondrial membranes can be attempted for functional studies

How can researchers effectively measure UCP2 activity in canine mitochondria?

Several complementary approaches provide insights into UCP2 function:

  • Proton leak kinetics: Measure relationship between oxygen consumption and membrane potential using:

    • Oxygen electrodes or Seahorse analyzers

    • Membrane potential-sensitive dyes (TMRM, JC-1)

    • Incremental inhibition of respiration to plot leak curves

  • Ion transport assays:

    • Patch-clamp of mitochondrial membranes

    • Ion-selective electrodes

    • Fluorescent probes for proton movement

  • Considerations for accurate measurements:

    • Use appropriate activators (fatty acids, superoxide generators)

    • Include specific inhibitors (GDP, genipin)

    • Account for other uncoupling mechanisms (ANT, lipid peroxidation)

    • Compare tissues with different UCP2 expression levels

  • Controls: Include UCP1-containing mitochondria as positive controls for uncoupling activity .

What biochemical challenges exist in distinguishing UCP2 effects from other mitochondrial proteins?

Several technical challenges complicate the study of UCP2-specific effects:

  • Low abundance: UCP2 is expressed at much lower levels than UCP1, making its uncoupling activity harder to detect and measure .

  • Multiple leak pathways: Other proteins contribute to proton leak:

    • Adenine nucleotide translocase (ANT)

    • Other members of the mitochondrial carrier family

    • Non-specific leak through damaged membranes

  • Methodological approaches to overcome these challenges:

    • Use specific inhibitors for different leak pathways

    • Generate comparative proteomics data to account for expression of other carriers

    • Implement genetic approaches (gene silencing, overexpression) to isolate UCP2 effects

    • Employ mathematical modeling to deconvolute multiple contributors to observed phenotypes

How might canine UCP2 function in breed-specific metabolic adaptations?

Different dog breeds show distinct metabolic characteristics that may correlate with UCP2 function:

  • Breed-specific analyses: Compare UCP2 expression, polymorphisms, and function across breeds with:

    • Different predispositions to metabolic diseases

    • Varying energy requirements

    • Diverse evolutionary/selective histories

  • Research approaches:

    • Analyze UCP2 polymorphism frequencies across breeds

    • Correlate polymorphisms with metabolic parameters

    • Compare mitochondrial function in tissues from different breeds

    • Develop breed-specific reference ranges for UCP2 expression

  • Example finding: Initial studies suggest that UCP3 SNPs (but not UCP2) are associated with total cholesterol levels in Labrador Retrievers, with allele frequencies differing between breeds susceptible to hypercholesterolemia (Shetland Sheepdogs) versus control breeds (Shiba) .

How can researchers resolve contradictions in UCP2 function across different experimental systems?

The literature contains numerous contradictions regarding UCP2 function. To address these:

  • Standardized methodology:

    • Develop consensus protocols for measuring uncoupling activity

    • Establish standardized positive and negative controls

    • Create reference standards for UCP2 expression levels

  • Context considerations:

    • Account for tissue-specific factors that may modify UCP2 function

    • Consider post-translational modifications in different physiological states

    • Examine protein-protein interactions that may regulate activity

    • Assess the impact of substrate availability on observable function

  • Multi-laboratory validation:

    • Conduct collaborative studies using identical protocols

    • Share biological materials to minimize variability

    • Establish repository of validated reagents (antibodies, recombinant proteins)

What therapeutic applications might emerge from manipulating canine UCP2 in disease states?

Based on findings primarily from human and rodent studies, UCP2 manipulation shows therapeutic potential:

  • Potential applications in canine medicine:

    • Cardiovascular protection: UCP2 overexpression shows beneficial effects on hyperglycemia and high-salt diet-induced endothelial dysfunction

    • Metabolic disorders: UCP2 modulation might improve glucose metabolism and insulin sensitivity

    • Neuroprotection: UCP2 may have protective effects against oxidative stress-induced neuronal damage

  • Therapeutic approaches to consider:

    • Pharmacological UCP2 induction: Several compounds (fenofibrate, sitagliptin, berberine, curcumin, capsaicin) can induce UCP2 expression

    • Genetic approaches: Viral vector-mediated UCP2 overexpression in targeted tissues

    • Dietary interventions: Specific nutrients may modulate UCP2 expression and function

  • Translational gaps to address:

    • Develop canine-specific pharmacokinetic/pharmacodynamic models

    • Establish clinically relevant biomarkers for UCP2 activity

    • Identify patient populations most likely to benefit from UCP2-targeted therapies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.