Recombinant Dog Mitochondrial uncoupling protein 3 (UCP3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
UCP3; SLC25A9; Mitochondrial uncoupling protein 3; UCP 3; Solute carrier family 25 member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
UCP3
Target Protein Sequence
MVGLKPSEVPPTTAVKFLGAGTAACFADLLTFPLDTAKVRLQIQGENQATQAARRIQYRG VLGTILTMVRTEGPRSPYNGLVAGLQRQMSFASIRIGLYDSVKQFYTPKGSDHSSITTRI LAGCTTGAMAVSCAQPTDVVKVRFQASIHLGAGSNRKYSGTMDAYRTIAREEGVRGLWKG TLPNITRNAIVNCAEMVTYDIIKEKLLDYHLLTDNFPCHLISAFGAGFCATVVASPVDVV KTRYMNSPPGQYCSPLDCMLKMVTQEGPTAFYKGFTPSFLRLGTWNVVMFVTYEQLKRAL MKVQMLRESPF
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane, thereby uncoupling oxidative phosphorylation. This process results in energy dissipation as heat. UCPs may play a role in regulating tissue respiratory control. They are involved in thermogenesis and energy balance.
Gene References Into Functions
  1. The UCP3 gene in dogs may be associated with total cholesterol levels. PMID: 25495519
Database Links

KEGG: cfa:403575

UniGene: Cfa.92

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of dog mitochondrial UCP3?

Dog mitochondrial uncoupling protein 3 (UCP3) serves as a specialized metabolite transporter in the inner mitochondrial membrane, facilitating the exchange of various metabolites including aspartate, malate, sulphate, and phosphate. While initially thought to function primarily as a proton transporter that decreases respiratory efficiency, recent evidence suggests its role is more complex and multifaceted . UCP3 appears to be integral to fatty acid oxidation (FAO) metabolism, potentially by facilitating fatty acid transport into mitochondria . In experimental models, UCP3 knockout (KO) demonstrates increased coupling of mitochondrial respiration, confirming its role in physiological uncoupling .

To accurately characterize dog UCP3 function, researchers should employ multiple methodological approaches, including liposome reconstitution experiments with purified recombinant protein, respiration measurements in isolated mitochondria, and metabolic flux analysis. These techniques provide complementary data on transport activity, substrate specificity, and physiological impact on energy metabolism.

How does UCP3 expression change during development and in different physiological states?

UCP3 expression demonstrates significant developmental regulation and responsiveness to physiological conditions. In cardiac tissue, UCP3 abundance increases during maturation and correlates with the establishment of fatty acid oxidation (FAO) as the predominant metabolic pathway . This expression pattern coincides with the appearance of specific cardiac markers (SERCA2, TnC, GATA4) and structural changes in mitochondria, including increased cristae density .

To study developmental and physiological regulation of dog UCP3, researchers should employ techniques such as quantitative PCR, western blotting, and immunohistochemistry across different developmental stages and physiological conditions. Time-course studies during differentiation protocols can provide valuable insights into the relationship between UCP3 expression and metabolic maturation.

What are the most reliable methods for quantifying UCP3 in canine samples?

For accurate quantification of UCP3 in canine samples, enzyme-linked immunosorbent assay (ELISA) represents a highly sensitive approach with detection limits reaching 0.285 ng/mL . Western blotting using antibodies raised against conserved epitopes (such as those encoded by exon 4) can verify protein specificity and relative abundance . For comprehensive analysis, researchers should combine protein quantification with functional assays.

When conducting UCP3 quantification experiments, sample preparation is critical. Mitochondrial isolation protocols significantly impact results, with differential centrifugation methods potentially introducing variability. Researchers should standardize isolation procedures and include appropriate controls for mitochondrial content (such as citrate synthase activity or mitochondrial DNA quantification) to normalize UCP3 measurements. For tissue samples, considerations of metabolic state and sample timing are essential, as UCP3 levels fluctuate with feeding status and diurnal rhythms.

How does the substrate specificity of dog UCP3 compare to other UCP family members?

Dog UCP3 shares significant functional similarities with other UCP family members but exhibits distinct substrate specificity and transport kinetics. While UCP3 catalyzes the exchange of aspartate, malate, sulphate, and phosphate similar to UCP2, the two proteins differ significantly in their transport mode and kinetic constants . Unlike UCP1, which primarily functions in thermogenesis, UCP3 appears specialized for metabolite transport related to fatty acid metabolism .

To characterize substrate specificity differences, reconstitution studies in liposomes represent the gold standard approach. These experiments should systematically compare transport rates for various substrates under controlled conditions. Researchers should consider utilizing site-directed mutagenesis to identify critical residues for substrate binding and transport. The R282Q mutation abolishes transport activity in human UCP3 , suggesting a potential conserved residue for examination in dog UCP3. Comparative kinetic analysis between different UCP family members should include determination of Km and Vmax values for each substrate to quantify affinity and transport capacity differences.

What molecular mechanisms explain the dual roles of UCP3 in fatty acid metabolism and ROS regulation?

The molecular architecture of UCP3 supports dual functionality in fatty acid metabolism and reactive oxygen species (ROS) regulation. Current evidence suggests that UCP3 facilitates fatty acid transport, potentially enabling fatty acid entry into mitochondria for oxidation . This function is supported by the observation of tight connections between large lipid droplets and mitochondria during peak UCP3 expression . Simultaneously, UCP3-mediated mild uncoupling reduces mitochondrial membrane potential, thereby decreasing ROS production .

These dual functions may be mechanistically linked through conformational changes in the protein structure. Research approaches to elucidate these mechanisms should include molecular dynamics simulations of UCP3 under different substrate and membrane potential conditions. Experimental validation through site-directed mutagenesis of putative fatty acid binding sites and functional assessment of mutant proteins would provide critical insights. Advanced imaging techniques, including super-resolution microscopy, can visualize UCP3 localization at contact sites between mitochondria and lipid droplets. Metabolic flux analysis using labeled fatty acids would quantify the impact of UCP3 manipulation on fatty acid transport and oxidation rates.

How do post-translational modifications affect UCP3 function and regulation?

Post-translational modifications (PTMs) represent a critical but understudied aspect of UCP3 regulation. While limited data exists specifically for dog UCP3, studies of homologous proteins suggest that phosphorylation, glutathionylation, and carbonylation significantly impact function. These modifications may serve as molecular switches that adapt UCP3 activity to metabolic conditions and oxidative stress levels.

To investigate PTMs of dog UCP3, researchers should employ a combination of mass spectrometry-based proteomics, site-directed mutagenesis, and functional assays. Phosphoproteomic analysis of UCP3 immunoprecipitated from canine tissues under different physiological conditions (fasting, exercise, high-fat feeding) would identify regulated phosphorylation sites. Mutation of these sites to phosphomimetic (aspartate/glutamate) or phospho-deficient (alanine) residues would enable functional characterization of each modification. For redox-related PTMs, differential alkylation techniques coupled with mass spectrometry can map reactive cysteine residues susceptible to modification. Correlation of PTM patterns with functional outcomes would establish a regulatory framework for UCP3 activity modulation.

What explains the paradoxical induction of UCP3 during conditions of high energy demand?

The induction of UCP3 during high energy demand states (fasting, exercise) presents a paradox given its presumed uncoupling function . This apparent contradiction is resolved by understanding UCP3's role beyond simple uncoupling. Recent evidence suggests that UCP3 primarily functions as a metabolite transporter facilitating fatty acid metabolism rather than primarily causing energetically wasteful proton leak .

During fasting and exercise, increased fatty acid availability necessitates enhanced mitochondrial fatty acid oxidation capacity. UCP3 induction supports this metabolic adaptation by facilitating fatty acid transport into mitochondria . Additionally, the mild uncoupling activity of UCP3 may protect against excessive ROS production during increased oxidative metabolism, preventing oxidative damage to mitochondrial components.

Research approaches to investigate this paradox should include metabolic flux analysis using stable isotope-labeled substrates in models with controlled UCP3 expression. Simultaneous measurement of fatty acid oxidation rates, mitochondrial membrane potential, and ROS production would establish the metabolic consequences of UCP3 induction. In vivo studies comparing wild-type and UCP3-deficient animals during fasting or exercise challenges would reveal the physiological importance of UCP3 induction during high energy demand states.

What are the optimal conditions for recombinant expression and purification of dog UCP3?

Successful recombinant expression and purification of dog UCP3 requires careful optimization of expression systems, solubilization conditions, and purification protocols. Based on successful approaches with human UCP3, bacterial expression systems using E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) represent effective platforms . The protein should be expressed with an affinity tag (His6 or FLAG) to facilitate purification.

Induction conditions significantly impact yield and quality of recombinant UCP3. Typical protocols employ isopropyl β-d-1-thiogalactopyranoside (IPTG) at concentrations of 0.5-1 mM, with induction at lower temperatures (16-20°C) to enhance proper folding . Following expression, membrane fraction isolation through differential centrifugation, followed by solubilization using mild detergents (n-dodecyl-β-D-maltoside or digitonin at 1-2% w/v) preserves protein structure and function.

Purification should employ a multi-step approach, beginning with affinity chromatography (Ni-NTA for His-tagged proteins), followed by size exclusion chromatography to ensure homogeneity. Protein quality assessment should include SDS-PAGE, western blotting, and circular dichroism spectroscopy to confirm structural integrity. For functional studies, reconstitution into liposomes requires careful optimization of lipid composition and protein-to-lipid ratios to maintain native activity.

How should researchers design experiments to differentiate between UCP3's proton transport and metabolite transport functions?

Designing experiments to distinguish between proton transport and metabolite transport functions of UCP3 requires specialized approaches that isolate each activity. For proton transport assessment, reconstituted liposomes loaded with pH-sensitive fluorescent dyes (such as BCECF or pyranine) enable monitoring of proton flux in response to imposed potentials. Alternatively, patch-clamp electrophysiology of giant liposomes containing purified UCP3 provides direct measurement of proton conductance.

For metabolite transport studies, researchers should employ isotope-labeled substrates and measure their exchange across liposomal membranes containing reconstituted UCP3. This approach enables quantification of transport kinetics for specific metabolites, including aspartate, malate, sulphate, and phosphate . To differentiate between exchange and uniport mechanisms, researchers should systematically vary internal and external substrate concentrations and measure net flux.

Critical controls include parallel experiments with known inhibitors of UCP function (such as GDP or genipin) and mutant versions of UCP3 with abolished transport activity (e.g., R282Q) . Comprehensive characterization should include determination of substrate specificity, transport mode (exchange versus uniport), kinetic parameters, and inhibitor sensitivity for both proton and metabolite transport functions.

What techniques provide the most reliable assessment of UCP3 function in isolated mitochondria?

Assessment of UCP3 function in isolated mitochondria requires a suite of complementary techniques that measure different aspects of mitochondrial bioenergetics. Oxygen consumption measurements using high-resolution respirometry provide direct assessment of coupling efficiency through determination of state 3 (ADP-stimulated) and state 4 (leak) respiration rates . The ratio of state 3 to state 4 respiration indicates the degree of coupling, with lower ratios suggesting higher UCP3 activity .

Membrane potential measurements using potential-sensitive fluorescent dyes (TMRM, JC-1) or electrode-based approaches (TPP+ electrode) quantify the proton gradient across the inner mitochondrial membrane. UCP3 activity manifests as decreased membrane potential under basal conditions or accelerated dissipation of membrane potential in response to fatty acids.

For metabolite transport function, assessment of substrate exchange rates using radiolabeled compounds provides direct measurement of UCP3-mediated transport in intact mitochondria. Researchers should systematically compare transport rates between mitochondria from wild-type and UCP3-deficient or overexpressing models to establish UCP3-dependent components.

Experimental designs should include appropriate controls for mitochondrial content, integrity, and respiratory capacity. Protocols must standardize substrate selection, as UCP3 activity varies with different respiratory substrates. Palmitoyl-carnitine or other fatty acid substrates often reveal UCP3-dependent effects most clearly, consistent with its role in fatty acid metabolism .

How do the functional characteristics of dog UCP3 compare to human and rodent orthologs?

Comparative analysis of dog UCP3 with human and rodent orthologs reveals both conserved and species-specific features with significant research implications. While the primary structure shows high conservation across mammals, subtle sequence differences may influence substrate specificity, regulatory mechanisms, and protein-protein interactions. Human UCP3 demonstrates strict exchange of aspartate, malate, sulphate, and phosphate , and the R282Q mutation abolishes transport activity . These characteristics provide reference points for examining dog UCP3.

Research approaches for comparative analysis should include sequence alignment, homology modeling, and cross-species functional studies. Recombinant expression of dog, human, and rodent UCP3 under identical conditions, followed by parallel functional characterization, would identify species-specific differences. Transgenic models expressing dog UCP3 in rodent backgrounds could reveal functional conservation or divergence in vivo.

What insights can dog UCP3 research provide for understanding mitochondrial dysfunction in metabolic disorders?

Dog UCP3 research offers valuable insights into mitochondrial dysfunction underlying metabolic disorders, with potential translational implications for both veterinary and human medicine. Dysregulation of UCP3 has been linked to metabolic disorders, obesity, and insulin resistance in dogs , mirroring associations observed in humans. This parallel makes canine UCP3 research particularly relevant for comparative medicine.

The role of UCP3 in fatty acid metabolism and ROS regulation positions it as a potential therapeutic target for metabolic conditions characterized by lipid overload and oxidative stress. Investigating how UCP3 function changes in canine models of obesity, diabetes, or heart failure could identify mechanistic pathways relevant to human disease. Dogs represent an advantageous model due to their relatively large size, tractable genetics, and development of spontaneous metabolic conditions similar to humans.

Research approaches should include prospective studies correlating UCP3 expression and function with metabolic parameters in healthy and diseased dogs. Longitudinal assessment of UCP3 levels during disease progression would establish its potential as a biomarker. Mechanistic studies using primary cells or tissues from affected animals would connect UCP3 dysfunction to specific pathophysiological processes. Therapeutic interventions targeting UCP3 (such as specific activators or inhibitors) could provide proof-of-concept for metabolic disorder treatment strategies.

What are the most common pitfalls in recombinant UCP3 expression and how can they be addressed?

Recombinant expression of UCP3 presents several technical challenges that researchers must address for successful experiments. As a hydrophobic membrane protein with multiple transmembrane domains, UCP3 often aggregates during expression, resulting in inclusion bodies with misfolded protein. This issue typically manifests as high expression levels detected by SDS-PAGE but minimal functional protein recovery.

To overcome aggregation issues, researchers should optimize expression conditions by reducing induction temperature (16-18°C), lowering inducer concentration, and extending expression time (16-24 hours). Specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3)) significantly improve proper folding and membrane insertion. Addition of chemical chaperones (glycerol 5-10%, sucrose 5%) to culture media can enhance proper folding.

Another common issue involves proteolytic degradation during purification, resulting in multiple bands on western blots. This problem can be addressed by including protease inhibitor cocktails at all purification steps and maintaining low temperatures throughout the procedure. Optimization of detergent selection is critical, as overly harsh detergents may denature the protein while insufficient solubilization limits yield. Systematic screening of detergent types (n-dodecyl-β-D-maltoside, digitonin, CHAPS) and concentrations identifies optimal conditions for each preparation.

How can researchers address the lack of specific antibodies for dog UCP3?

The limited availability of dog-specific UCP3 antibodies presents a significant challenge for canine research. To address this issue, researchers should employ a multi-faceted approach. First, cross-reactivity testing of existing antibodies against human or rodent UCP3 may identify reagents with sufficient specificity for dog studies. Antibodies raised against conserved epitopes (particularly those in exon 4) often demonstrate cross-species reactivity .

For improved specificity, researchers should consider developing custom antibodies using peptide sequences unique to dog UCP3. Epitope mapping analysis identifies regions with high antigenicity and minimal homology to other UCPs, reducing cross-reactivity concerns. Validation of new antibodies should include western blotting against recombinant dog UCP3, UCP1, and UCP2 to confirm specificity within the UCP family.

Alternative approaches include using tagged recombinant proteins for in vitro studies, allowing detection with tag-specific antibodies (His, FLAG, etc.). For tissue expression studies, RNAscope or other in situ hybridization techniques provide specific detection of UCP3 mRNA without antibody dependence. Mass spectrometry-based proteomics offers another antibody-independent approach for UCP3 detection and quantification in complex samples.

What strategies help resolve contradictory results in UCP3 functional studies?

Contradictory results in UCP3 functional studies often stem from methodological variations, species differences, or context-dependent activities. To resolve such contradictions, researchers should implement systematic comparative approaches and standardized protocols.

When faced with contradictory literature, researchers should perform detailed methodological analysis to identify procedural differences that might explain discrepancies. Key variables include mitochondrial isolation methods, buffer compositions, substrate concentrations, and analytical techniques. Side-by-side experiments using multiple methodological approaches provide stronger evidence than single-method studies.

Context-dependent UCP3 function represents another source of apparent contradictions. UCP3 activity varies with metabolic state, substrate availability, and oxidative stress levels. Experiments should control and explicitly report these variables. For example, UCP3's effect on mitochondrial coupling may differ when measured with carbohydrate versus fatty acid substrates .

Species differences in UCP3 regulation and function should be considered when comparing results across studies. When possible, parallel experiments using samples from multiple species under identical conditions help distinguish species-specific from conserved characteristics. Finally, researchers should consider the possibility that contradictory results reflect genuine biological complexity, with UCP3 serving different functions under different physiological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.