Recombinant Dog Myelin and lymphocyte protein (MAL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
MAL; Myelin and lymphocyte protein; T-lymphocyte maturation-associated protein; VIP17 proteolipid
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
MAL
Target Protein Sequence
MAPAAASGGSSLPSGFSVFTTFPDLLFIFEFIFGGLVWILIASSLVPIPLVQGWVMFVSV FCFMATTALLVLYIIGAHGGENSWVTLDAAYHCIAALFYLSASVLEALATIGMQEGYTYK QYHENISAVVFSYVATLLYVVHAVFSLIRWKSS
Uniprot No.

Target Background

Function
Myelin and lymphocyte protein (MAL) could play a crucial role in vesicular trafficking cycling between the Golgi complex and the apical plasma membrane. It may also be involved in myelin biogenesis and/or myelin function.
Gene References Into Functions
  1. VIP17/MAL overexpression is associated with shortened or absent cilia in Madin-Darby canine kidney (MDCK) cells. PMID: 22895261
  2. The exclusion of MAL from the expanding 2D crystals of uroplakins explains the selective association of MAL with the hinge areas in the uroplakin-delivering fusiform vesicles, as well as at the apical surface. PMID: 22323295
Database Links
Protein Families
MAL family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Myelin and Lymphocyte protein (MAL) and what is its function in canines?

Myelin and Lymphocyte protein (MAL) is a membrane component expressed primarily by oligodendrocytes and Schwann cells in the canine nervous system. It plays a crucial role in the myelin formation process, where membrane-associated proteins must be sorted and transported to specified membrane regions such as compact and non-compact myelin membranes. Research has identified MAL as a key component in the apical sorting machinery of polarized cells, suggesting its importance in the organization and maintenance of myelin structure. The protein is involved in sorting myelin membrane-associated molecules, which is essential for proper myelination and nervous system function in canines .

How does canine MAL protein compare structurally to MAL proteins from other species?

Canine MAL shares structural similarities with MAL proteins from other mammalian species, but with species-specific variations that affect its functionality. Research has demonstrated that cells expressing MAL from different species (such as sheep or human) can exhibit differential responses to certain ligands or toxins. For example, the Clostridium perfringens epsilon toxin shows varying levels of toxicity toward cells expressing human MAL (hMAL) versus sheep MAL (sMAL), with some toxin variants showing 2.3-fold increased toxicity towards cells expressing human MAL while demonstrating an 8.6-fold reduction in toxicity towards cells expressing sheep MAL compared to wild-type toxin . These differences suggest structural variations in the receptor-binding domains of MAL across species that influence protein-protein interactions and functional outcomes.

What cellular localization patterns are observed for canine MAL protein?

In canine neural cells, MAL protein is primarily localized to specialized membrane microdomains known as detergent-insoluble glycolipid-enriched complexes (DIGs) or lipid rafts. When expressed as a GFP-fusion protein (with GFP at the N-terminus), MAL maintains its natural distribution pattern within the cell, becoming enriched in these detergent-insoluble microdomains similar to untagged native MAL . This localization is functionally significant as it places MAL in membrane regions critical for signaling and protein sorting. Notably, when the GFP tag is placed at the C-terminus (MAL-GFP), proper transport and localization are disrupted, indicating that the C-terminal domain of MAL is critical for its correct trafficking within canine neural cells .

What are the optimal methods for generating functional recombinant dog MAL protein constructs?

For generating functional recombinant dog MAL protein constructs, N-terminal tagging has proven more successful than C-terminal tagging. Research demonstrates that when creating fusion proteins with green fluorescent protein (GFP), placement of GFP at the N-terminus (GFP-MAL) produces a construct that closely resembles the expression pattern and functionality of native MAL . In contrast, C-terminal fusion constructs (MAL-GFP) show improper cellular transport, suggesting interference with critical C-terminal domains.

The recommended methodology includes:

  • PCR amplification of the canine MAL coding sequence from appropriate neural tissue

  • Subcloning into an expression vector with the GFP sequence positioned at the N-terminus

  • Verification of the construct through sequencing

  • Transfection into an appropriate cell line (such as Oli-neu oligodendrocyte cell line)

  • Confirmation of expression through fluorescence microscopy and biochemical analysis of detergent-insoluble fractions

For tissue-specific expression studies, incorporating the MAL promoter (approximately 8-kb fragment) upstream of the GFP-MAL fusion construct enables cell-specific expression that responds appropriately to differentiation signals such as cAMP .

How can researchers establish reliable detection methods for recombinant dog MAL protein in biological samples?

Establishing reliable detection methods for recombinant dog MAL protein requires a multi-faceted approach that combines immunological and biochemical techniques. Based on established protocols for detecting recombinant proteins in canine samples, the following methodological framework is recommended:

  • Sandwich ELISA Development:

    • Coat high-binding microtiter plates with anti-recombinant dog MAL protein antibody (optimal concentration typically 1 μg/ml)

    • Block with 5% BSA in DPBS

    • Dilute samples in appropriate buffer (such as LowCross-Buffer) to minimize matrix effects

    • Use species-specific detecting antibodies at optimized concentrations (approximately 0.125 μg/ml)

  • Western Blotting Protocol:

    • Separate proteins using SDS-PAGE under denaturing conditions

    • Transfer to appropriate membrane

    • Block with 5% non-fat milk or BSA

    • Probe with anti-MAL antibody or anti-tag antibody if the recombinant protein contains an affinity tag

    • Include appropriate positive controls (such as HRP-labeled anti-histidine antibody for His-tagged proteins) and negative controls (normal canine serum)

  • Validation Parameters:

    • Establish linear detection range (typically 25-3,200 ng/ml for canine proteins in serum)

    • Determine assay specificity by testing with samples containing related proteins

    • Validate reproducibility through inter-assay and intra-assay coefficient of variation calculations

What cell lines are appropriate for studying recombinant dog MAL protein expression and function?

For studying recombinant dog MAL protein expression and function, researchers should select cell lines based on the specific aspects of MAL biology being investigated. Based on established research approaches, the following cell models are recommended:

  • Oli-neu oligodendrocyte cell line: This murine oligodendrocyte precursor cell line has been successfully used for MAL expression studies. When transfected with constructs containing the MAL promoter, these cells express GFP-MAL only upon differentiation stimulation with cAMP, making them suitable for studying differentiation-dependent regulation of MAL expression .

  • MDCK cells: Madin-Darby Canine Kidney cells are widely used for studying protein trafficking in polarized epithelial cells and are appropriate for investigating the role of MAL in apical sorting machinery.

  • CHO cells expressing canine MAL: Chinese Hamster Ovary cells can be engineered to express dog MAL, creating a stable expression system for functional studies. CHO cells transfected with species-specific MAL (such as canine, human, or sheep MAL) have been used to study differential responses to ligands and toxins .

  • Primary canine oligodendrocytes or Schwann cells: While more challenging to maintain, these cells provide the most physiologically relevant environment for studying native MAL function.

When selecting a cell model, researchers should consider:

  • The need for polarized cell architecture

  • Endogenous expression of MAL interaction partners

  • Species-specific variations in MAL sequence and function

  • Requirements for differentiation-dependent expression studies

How does recombinant dog MAL protein incorporation into lipid rafts affect its functional properties?

Recombinant dog MAL protein's incorporation into lipid rafts is fundamental to its functional properties, representing a critical aspect of its biological activity. Research demonstrates that GFP-MAL fusion proteins are enriched in detergent-insoluble glycolipid-enriched microdomains (DIGs), commonly known as lipid rafts, mirroring the behavior of untagged native MAL . This incorporation has several significant functional implications:

  • Membrane Organization: Within lipid rafts, MAL contributes to the organization of specialized membrane domains crucial for myelin formation. The protein's presence in these detergent-insoluble complexes facilitates the clustering of specific lipids and proteins required for proper myelin membrane assembly.

  • Protein Sorting: MAL's localization to lipid rafts directly influences its capacity to participate in the apical sorting machinery of polarized cells. This positioning allows MAL to interact with and direct the trafficking of other myelin membrane components to their appropriate destinations within the developing myelin sheath.

  • Signal Transduction: The incorporation of MAL into lipid rafts positions it within signaling platforms that regulate oligodendrocyte and Schwann cell differentiation and myelin maintenance. This spatial organization influences how MAL participates in or modulates signaling cascades critical for myelination processes.

  • Receptor Function: MAL's presence in lipid rafts affects its activity as a receptor for certain ligands. For instance, the susceptibility of MAL-expressing cells to Clostridium perfringens epsilon toxin is directly related to MAL's incorporation into these specialized membrane domains, as demonstrated by differential toxicity patterns between various MAL constructs .

The organization of MAL within lipid rafts appears to be dependent on specific structural features of the protein, as evidenced by the observation that N-terminal fusion constructs (GFP-MAL) maintain proper raft incorporation while C-terminal fusions (MAL-GFP) do not .

How does recombinant dog MAL interact with Clostridium perfringens epsilon toxin, and what are the implications for neurotoxicity studies?

Recombinant dog MAL serves as a receptor for Clostridium perfringens epsilon toxin, with this interaction having significant implications for understanding species-specific neurotoxicity patterns. Research has revealed several key aspects of this relationship:

The binding of epsilon toxin to MAL is highly specific, with the toxin demonstrating variable affinity depending on the species origin of the MAL protein. Cells expressing human MAL (hMAL) versus sheep MAL (sMAL) show differential susceptibility to the toxin, with some toxin variants displaying a 2.3-fold increased toxicity toward hMAL-expressing cells while showing an 8.6-fold reduction in toxicity toward sMAL-expressing cells compared to wild-type toxin . This suggests that canine MAL likely has its own distinct binding profile that influences species-specific sensitivity to the toxin.

Mutations in the epsilon toxin targeting its receptor-binding domain can significantly alter its toxicity toward MAL-expressing cells. For example, mutations Y30A-Y196A combined with either H149A or A168F resulted in marked reductions in toxicity toward cells expressing either human or sheep MAL . These findings indicate that specific structural elements of both the toxin and the MAL protein are critical for their interaction.

The MAL-epsilon toxin interaction has substantial implications for understanding neurotoxicity mechanisms in canines. Since MAL is expressed by oligodendrocytes and Schwann cells, the binding of the toxin to this protein helps explain the characteristic demyelinating pathology observed in epsilon toxin intoxication.

This interaction also provides potential targets for therapeutic intervention. Research into toxin variants with reduced binding to MAL has led to the development of promising genetic toxoids for vaccination, suggesting similar approaches could be effective for protecting canines from neurotoxicity .

For researchers studying canine neurological disorders, understanding the MAL-epsilon toxin interaction offers valuable insights into mechanisms of blood-brain barrier disruption and demyelination that may be relevant to both infectious and non-infectious neurological conditions.

What are common challenges in expressing recombinant dog MAL protein, and how can they be addressed?

Researchers working with recombinant dog MAL protein frequently encounter several technical challenges that can impact experimental outcomes. Based on published research methodologies, these challenges and their solutions include:

  • Incorrect Subcellular Localization

    • Challenge: Fusion tag position can disrupt normal MAL trafficking and localization.

    • Solution: Research clearly demonstrates that N-terminal tagging (GFP-MAL) preserves normal MAL expression patterns, while C-terminal tagging (MAL-GFP) disrupts proper transport . Always position tags at the N-terminus of MAL and verify localization through colocalization studies with established lipid raft markers.

  • Low Expression Levels

    • Challenge: Insufficient expression of recombinant MAL for functional studies.

    • Solution: When using MAL's native promoter elements, expression may be dependent on cellular differentiation state. Stimulate Oli-neu oligodendrocyte cells with cAMP to induce differentiation and enhance MAL expression . Alternatively, use stronger constitutive promoters (CMV, EF1α) when cell-type specificity is less critical.

  • Protein Aggregation

    • Challenge: MAL's highly hydrophobic nature as a proteolipid can lead to aggregation.

    • Solution: Optimize extraction and purification protocols using mild detergents that preserve membrane protein structure. Consider using specialized fusion partners that enhance solubility while maintaining functionality.

  • Functional Assessment Difficulties

    • Challenge: Determining whether recombinant MAL retains native functionality.

    • Solution: Verify incorporation into detergent-insoluble glycolipid-enriched microdomains (DIGs) as a key indicator of proper folding and function . Test functionality through binding assays with known MAL interactors or through functional complementation in MAL-deficient cellular models.

  • Antibody Recognition Issues

    • Challenge: Antibodies failing to recognize the recombinant MAL protein.

    • Solution: Develop detection strategies using both anti-MAL antibodies and anti-tag antibodies (when applicable). For western blotting applications, include appropriate positive controls (such as HRP-labeled anti-histidine antibody for His-tagged proteins) and negative controls (normal canine serum) .

How can researchers optimize transfection efficiency when working with dog MAL constructs in different cell types?

Optimizing transfection efficiency for dog MAL constructs requires careful consideration of cell type, construct design, and transfection methodology. Based on established research practices, the following strategies are recommended:

  • Cell Type-Specific Optimization

    For oligodendrocyte cell lines (e.g., Oli-neu):

    • Nucleofection typically achieves higher efficiency than lipid-based methods

    • Maintain cells at lower passage numbers (under 20) for optimal transfection

    • For MAL promoter-driven constructs, ensure cells are responsive to differentiation cues by pre-testing with cAMP stimulation

    For epithelial cell lines (e.g., MDCK):

    • Lipid-based transfection reagents generally work well

    • Transfect cells at 70-80% confluence for balance between efficiency and viability

    • Consider stable transfection approaches for long-term expression studies

  • Construct Design Considerations

    • Maintain the GFP tag at the N-terminus of MAL to preserve proper protein trafficking

    • Optimize codon usage for canine expression if using synthetic genes

    • Include appropriate Kozak sequence for efficient translation initiation

    • Consider the vector backbone carefully—CMV promoters work well for constitutive expression, while using the 8-kb MAL promoter fragment enables cell type-specific, differentiation-dependent expression

  • Transfection Protocol Optimization

    • For transient transfection, harvest cells 24-48 hours post-transfection for optimal expression

    • When using the MAL promoter, allow 24-48 hours for differentiation induction (e.g., with cAMP) after transfection before assessing expression

    • Pre-warm all reagents and DNA to room temperature before transfection

    • Use serum-free media during the initial transfection period, then replace with complete media

  • Verification Methods

    • Use flow cytometry to quantify transfection efficiency for GFP-tagged constructs

    • Confirm functional expression by assessing incorporation into detergent-insoluble glycolipid-enriched microdomains

    • Validate expression using both fluorescence microscopy (for localization) and western blotting (for size verification)

What analytical approaches can resolve contradictory data regarding MAL protein function in different experimental systems?

When faced with contradictory data regarding MAL protein function across different experimental systems, researchers should implement systematic analytical approaches to resolve discrepancies. Based on research methodologies, the following strategies are recommended:

  • Species-Specific Variation Analysis

    Contradictory results may stem from species differences in MAL structure and function. Compare experimental findings using MAL from different species (e.g., canine, human, sheep) within the same experimental system. Research has demonstrated that human MAL (hMAL) and sheep MAL (sMAL) show markedly different interactions with the same ligands, such as epsilon toxin variants . When evaluating conflicting literature, carefully note the species origin of the MAL protein used.

    MAL SourceToxin VariantRelative ToxicityReference
    Human MALY30A-Y196A2.3× increase
    Sheep MALY30A-Y196A8.6× decrease
  • Functional Domain Mapping

    Systematically analyze which structural domains contribute to observed functional differences through targeted mutagenesis or domain swapping experiments. The differential behavior of N-terminal (GFP-MAL) versus C-terminal (MAL-GFP) fusion proteins provides evidence that specific domains critically influence MAL trafficking and function . Create a comprehensive table mapping specific domains to functions across experimental systems to identify consistent patterns.

  • Context-Dependent Function Assessment

    MAL function may be highly context-dependent. When analyzing contradictory data, consider:

    • Cell differentiation state (e.g., MAL expression under its native promoter occurs only in differentiated Oli-neu cells)

    • Membrane microdomain composition (lipid and protein components of rafts may vary between cell types)

    • Expression level effects (overexpression versus physiological levels)

    • Presence of cofactors or interaction partners

  • Methodology Standardization

    Develop standardized protocols for:

    • Detergent extraction conditions for lipid raft isolation

    • Functional assays for MAL activity

    • Expression systems and constructs

    • Quantification methods

    This standardization allows for direct comparison between results from different laboratories and experimental systems.

  • Integrated Data Analysis Framework

    Create a comprehensive analytical framework that integrates:

    • Biochemical data (protein-protein interactions, lipid associations)

    • Cellular localization patterns

    • Functional outcomes (sorting efficiency, response to ligands)

    • In vivo phenotypes when available

    This multi-dimensional analysis can reveal patterns that explain seemingly contradictory results by identifying the specific conditions under which different MAL functions predominate.

What are promising approaches for studying the role of dog MAL protein in myelination disorders?

Investigating the role of dog MAL protein in myelination disorders presents several promising research avenues that leverage emerging technologies and comparative biology approaches. Based on current research directions, the following approaches show particular promise:

  • CRISPR/Cas9-Mediated Genome Editing

    Developing canine-specific MAL knockout or knockin models using CRISPR/Cas9 technology would allow direct investigation of MAL function in relevant cell types. This approach could generate:

    • Complete MAL knockout models to study loss-of-function effects

    • Domain-specific mutations to investigate structure-function relationships

    • Reporter knockins (e.g., GFP-MAL under endogenous control) to study natural expression patterns

  • Organoid and 3D Culture Systems

    Canine neural organoids or 3D myelinating cultures would provide more physiologically relevant models than traditional 2D cultures while maintaining experimental accessibility. These systems could:

    • Allow visualization of MAL trafficking during active myelination

    • Enable assessment of how MAL variants affect myelin sheath formation

    • Facilitate testing of therapeutic approaches to restore normal MAL function

  • Comparative Studies Across Species

    Systematic comparison of MAL function across species can illuminate conserved versus species-specific aspects of MAL biology. This approach is particularly valuable given the demonstrated differences in how human MAL (hMAL) and sheep MAL (sMAL) interact with ligands such as epsilon toxin . Extending these comparisons to include canine MAL could reveal:

    • Species-specific vulnerabilities to myelination disorders

    • Evolutionarily conserved functional domains essential for MAL activity

    • Differential responses to potential therapeutic interventions

  • High-Resolution Imaging of MAL Dynamics

    Super-resolution microscopy and live-cell imaging of fluorescently tagged MAL would provide unprecedented insights into:

    • Temporal dynamics of MAL localization during myelination

    • Interaction with other myelin components in real-time

    • Responses to demyelinating stimuli or therapeutic agents

  • Integration with "Omics" Approaches

    Combining MAL functional studies with broader omics profiling could identify:

    • Transcriptional networks regulated by MAL in oligodendrocytes

    • Proteomic changes in MAL-deficient or MAL-mutant systems

    • Lipidomic alterations in myelin membranes with MAL dysfunction

These approaches, particularly when combined in multidisciplinary studies, offer significant potential for advancing our understanding of canine MAL protein's role in myelination disorders and developing targeted therapeutic strategies.

How might recombinant dog MAL be utilized in developing targeted therapies for canine demyelinating disorders?

Recombinant dog MAL protein offers several promising avenues for developing targeted therapies for canine demyelinating disorders. Based on current research directions, the following approaches show significant therapeutic potential:

  • MAL-Based Vaccine Strategies

    Similar to how modified epsilon toxin variants with reduced toxicity toward MAL-expressing cells have been developed as vaccine candidates , recombinant dog MAL could be utilized in vaccine strategies for canine demyelinating disorders with autoimmune components. This approach could:

    • Induce tolerization to MAL epitopes that are targets of autoimmune responses

    • Generate protective antibodies that prevent binding of autoantibodies to native MAL

    • Establish regulatory T-cell responses that suppress pathological inflammation in myelin

  • MAL-Targeted Drug Delivery Systems

    Leveraging MAL's specific expression in oligodendrocytes and Schwann cells and its incorporation into lipid rafts , MAL-targeted nanoparticles or liposomes could deliver therapeutic agents specifically to myelinating cells. This approach would:

    • Increase local concentration of therapeutic agents at sites of demyelination

    • Reduce off-target effects on non-myelinating cells

    • Enable delivery of agents that promote remyelination or protect oligodendrocytes

  • MAL-Based Screening Platforms

    Cells expressing recombinant dog MAL could serve as platforms for screening compounds that:

    • Stabilize MAL in lipid rafts to enhance its functional properties

    • Modulate MAL-dependent signaling pathways that influence myelination

    • Protect MAL-expressing cells from inflammatory or toxic insults

  • Gene Therapy Approaches

    For demyelinating disorders associated with MAL dysfunction, gene therapy vectors expressing functional MAL could restore normal myelination processes. Considerations include:

    • Viral vectors with tropism for oligodendrocytes and Schwann cells

    • Inducible or cell-type-specific promoters (such as the 8-kb MAL promoter)

    • Modified MAL constructs with enhanced stability or function

  • MAL Interaction Modifiers

    Small molecules or peptides designed to modulate interactions between MAL and its binding partners could:

    • Enhance beneficial protein-protein interactions that promote myelination

    • Disrupt pathological interactions that contribute to demyelination

    • Stabilize MAL in membrane microdomains to maintain myelin integrity

The development of these therapeutic approaches would benefit from incorporating the methodological insights gained from studies of recombinant MAL expression and function, particularly regarding the importance of N-terminal versus C-terminal modifications and the critical role of MAL incorporation into detergent-insoluble glycolipid-enriched microdomains .

What experimental approaches could elucidate the mechanisms of MAL-mediated protein sorting in canine oligodendrocytes?

Elucidating the mechanisms of MAL-mediated protein sorting in canine oligodendrocytes requires sophisticated experimental approaches that integrate molecular, cellular, and biophysical techniques. Based on current research methodologies, the following approaches would be particularly valuable:

  • Proximity Labeling Proteomics

    Implement BioID or APEX2 proximity labeling systems fused to canine MAL to identify proteins that interact with MAL in living oligodendrocytes. This approach would:

    • Reveal the composition of MAL-associated protein complexes in their native cellular context

    • Identify potential cargo proteins sorted by MAL

    • Discover previously unknown components of the oligodendrocyte sorting machinery

    The proven functionality of N-terminal fusion proteins (like GFP-MAL) suggests that N-terminal BioID or APEX2 fusions would likely preserve MAL's normal trafficking and function.

  • Live-Cell Cargo Tracking

    Utilize dual-color live-cell imaging with differentially labeled MAL and candidate cargo proteins to:

    • Visualize sorting events in real-time

    • Quantify kinetic parameters of sorting (rates, directionality)

    • Assess how perturbations of MAL function affect cargo trafficking

    This approach could leverage the established GFP-MAL construct paired with cargo proteins tagged with spectrally distinct fluorophores.

  • Lipid Raft Manipulation Experiments

    Since MAL is enriched in detergent-insoluble glycolipid-enriched microdomains (DIGs) , systematic manipulation of these domains would help define their role in MAL-mediated sorting:

    • Cholesterol depletion/loading to alter raft stability

    • Targeted modification of specific lipid species in rafts

    • Temperature manipulation to alter raft phase behavior

    These experiments would reveal how the biophysical properties of membrane microdomains influence MAL-dependent protein sorting.

  • Domain Mapping through Mutagenesis

    Create a systematic library of canine MAL mutants to identify specific domains required for different aspects of protein sorting:

    • Transmembrane domain mutants to assess membrane anchoring

    • Cytoplasmic domain mutants to identify interaction sites with sorting machinery

    • Extracellular/luminal domain mutants to evaluate cargo recognition

    The differential behavior of N-terminal versus C-terminal GFP fusions provides initial insights that could guide more targeted mutagenesis approaches.

  • Reconstitution in Model Membrane Systems

    Purify recombinant canine MAL and candidate cargo proteins for reconstitution in artificial membrane systems:

    • Giant unilamellar vesicles with defined lipid composition

    • Supported lipid bilayers for high-resolution imaging

    • Microfluidic membrane systems to study directed transport

    These reductionist approaches would establish whether MAL is sufficient for sorting or requires additional factors.

  • Developmental Time-Course Analysis

    Leverage the differentiation-dependent expression of MAL under its native promoter to analyze:

    • Temporal coordination between MAL expression and sorting of specific cargo proteins

    • Changes in sorting mechanisms during oligodendrocyte maturation

    • Correlation between MAL expression patterns and myelination stages

By combining these complementary approaches, researchers can build a comprehensive model of MAL-mediated protein sorting mechanisms in canine oligodendrocytes, potentially revealing novel therapeutic targets for demyelinating disorders.

How do functional properties of recombinant dog MAL compare with MAL proteins from other species in experimental settings?

The functional properties of recombinant dog MAL exhibit both conserved and species-specific characteristics when compared with MAL proteins from other species in experimental settings. Based on comparative research findings, several key differences and similarities emerge:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.