Recombinant Dog Neuropeptide Y receptor type 1 (NPY1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
NPY1R; Neuropeptide Y receptor type 1; NPY1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MNSTSFSQVENHSIFCNFSENSQFLAFESDDCHLPLAMIFTLALAYGAVIILGVTGNLAL IMIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQC VSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVVSSLPFLIYQVLTD EPFQNVTLDAFKDKYVCFDKFPSDSHRLSYTTLLLMLQYFGPLCFIFICYFKIYIRLKRR NNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLL FLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSK TSLKQASPVAFKKINNDDNEKI
Uniprot No.

Target Background

Function
Receptor for neuropeptide Y and peptide YY.
Gene References Into Functions
  1. Data support the hypothesis that NPY Y(1) receptors can produce vasoconstriction in exercising skeletal muscle PMID: 15210450
  2. These data support the hypothesis that NPY Y(1) receptors produce vasoconstriction in exercising skeletal muscle. [Neuropeptide Y1 receptor] PMID: 16099895
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of dog NPY1R and how does it compare to human NPY1R?

Dog NPY1R, like its human counterpart, belongs to the G protein-coupled receptor (GPCR) family. The NPY1R structure consists of seven transmembrane domains characteristic of GPCRs, with an extracellular N-terminus and intracellular C-terminus. Recent structural studies of human Y1R have revealed crucial binding sites and conformational changes upon ligand binding. When complexed with NPY and the G protein (Gi1), the receptor adopts an active conformation where the N-terminal residues of NPY form specific interactions with the receptor binding pocket .

For experimental work with dog NPY1R, researchers should note that the Y1 residue of NPY forms extensive contacts with the receptor, particularly with acidic residues in ECL2 and helix V. The positively charged N-terminal amino group forms a salt bridge with the acidic residue D205^5.32 in helix V, while the Y1 side-chain hydroxyl makes polar contact with D200 in ECL2 . These structural features are likely conserved across mammalian species including canines, though species-specific variations may exist in particular binding pocket residues.

What expression systems are most effective for producing functional recombinant dog NPY1R?

For functional expression of mammalian NPY1R, including dog variants, several expression systems have proven effective:

  • Mammalian cell lines: HEK293 and CHO cells are preferred for functional studies as they provide appropriate post-translational modifications and membrane insertion. When designing expression constructs, include a hemagglutinin (HA) signal peptide to enhance membrane trafficking and epitope tags (such as Flag at N-terminus and twin-strep-tag at C-terminus) to facilitate purification while maintaining receptor functionality .

  • Insect cell systems: Sf9 or High Five cells using baculovirus expression systems can produce higher yields of receptor protein for structural studies, though functional testing should confirm proper folding.

  • Stable cell lines: For consistent results in pharmacological assays, develop stable cell lines expressing dog NPY1R under inducible promoters.

Researchers should verify that modifications to facilitate expression and purification do not impair signaling properties through functional assays such as cAMP inhibition or IP accumulation tests .

What methods are most reliable for assessing the binding affinity of ligands to recombinant dog NPY1R?

Several methodologies provide reliable assessment of ligand binding to NPY1R:

  • NanoBRET-based binding assay: This approach effectively distinguishes between high-affinity and low-affinity binding states of NPY1R. The technique is particularly valuable for evaluating the functional contribution of key residues within the NPY binding pocket. Changes in BRET maximum (BRETmax) values of the high-affinity state indicate destabilization of the peptide-receptor-G protein complex .

  • Radioligand binding assays: Using radiolabeled NPY or synthetic analogs, competitive binding assays can determine Ki values for various ligands. This method should include proper controls for non-specific binding.

  • Fluorescence-based methods: Fluorescently labeled peptides combined with FRET or BRET approaches provide alternatives to radioligand binding.

For mutagenesis studies of the binding pocket, alanine scanning of key residues has revealed that mutations at positions F199, D200, and F286^6.58 significantly decrease NPY potency (4-20 fold) in IP accumulation assays . When designing binding studies with dog NPY1R, these conserved residues should be considered critical for proper ligand recognition.

How can recombinant dog NPY1R activity be measured in functional assays?

Since NPY1R primarily couples to Gi proteins, the following functional assays are most appropriate:

  • cAMP inhibition assays: Measure the ability of NPY1R activation to inhibit forskolin-stimulated cAMP production. This can be assessed using ELISA, radioimmunoassay, or cAMP-responsive reporter gene systems.

  • [Ca²⁺]i mobilization: NPY1R activation can trigger calcium mobilization through Gβγ-mediated pathways, measurable using calcium-sensitive fluorescent dyes.

  • IP accumulation assays: These assays have been successfully used to evaluate the functional consequences of mutations in the NPY1R binding pocket .

  • G protein coupling assays: Techniques such as [³⁵S]GTPγS binding assays measure the direct activation of G proteins following receptor stimulation.

  • β-arrestin recruitment: BRET-based assays can monitor the recruitment of β-arrestin to activated receptors, providing information about receptor desensitization pathways.

For more precise measurement of dog NPY1R activation dynamics, real-time PCR can be employed to quantify downstream signaling events, using methods similar to those described for other NPY receptor systems .

How do specific mutations in the binding pocket of dog NPY1R affect its pharmacological properties?

Site-directed mutagenesis studies have revealed critical residues in NPY1R that significantly impact ligand binding and receptor activation. Based on structural and functional analyses of human NPY1R, several key residues have been identified:

  • D200 in ECL2: Alanine substitution reduces NPY potency and destabilizes the high-affinity peptide-receptor-G protein complex . This residue forms a critical polar contact with the Y1 residue of NPY.

  • D205^5.32 in helix V: Forms a salt bridge with the N-terminal amino group of NPY. Mutations at this position would likely disrupt this essential interaction .

  • R208^5.35: Contributes to NPY binding, with alanine mutation reducing the stability of the high-affinity complex .

  • F286^6.58: Makes hydrophobic contacts with the Y1 residue of NPY; alanine replacement decreases NPY potency by 4-20 fold .

When investigating dog NPY1R, researchers should prioritize these conserved residues for mutagenesis studies. For comprehensive pharmacological characterization, mutations should be assessed through multiple assays:

MutationEffect on NPY BindingEffect on G Protein CouplingEffect on Signal Transduction
D200AReduced affinityDestabilized high-affinity complexDecreased potency in IP accumulation
R208^5.35AReduced bindingDestabilized high-affinity complexReduced signaling efficiency
F286^6.58AReduced hydrophobic interactionDestabilized high-affinity complex4-20 fold decrease in potency

For each mutation, measure changes in both binding affinity and functional responses to distinguish between effects on ligand recognition versus receptor activation.

What are the challenges in developing selective ligands for dog NPY1R, and how can they be addressed?

Developing selective ligands for dog NPY1R presents several challenges:

  • Structural similarity among NPY receptor subtypes: The high degree of homology between Y1R, Y2R, Y4R, and Y5R makes it difficult to achieve subtype selectivity. Recent structural studies have revealed distinct binding modes of NPY at Y1R versus Y2R, providing opportunities for rational design of selective ligands .

  • Species differences: While NPY1R is conserved across mammals, subtle differences exist between dog and human receptors that may affect ligand binding. Comparative homology modeling based on the recently solved human NPY1R structure can help predict dog-specific binding pocket variations.

  • Achieving desired pharmacodynamic properties: Developing ligands with appropriate bioavailability and blood-brain barrier penetration remains challenging.

To address these challenges:

  • Structure-based design approach: Utilize structural information from human Y1R in complex with NPY and G proteins to design ligands that exploit the unique features of the Y1R binding pocket .

  • Fragment-based screening: Identify small molecules that bind to specific subpockets within the NPY1R binding site and optimize these fragments into larger, selective ligands.

  • Allosteric modulator development: Target allosteric sites unique to NPY1R to achieve subtype selectivity.

  • Species-bridging approach: Design ligands that interact with conserved residues between dog and human NPY1R to facilitate translational research.

When evaluating selectivity, comprehensive screening against all NPY receptor subtypes expressed in the same system is essential to ensure true selectivity for NPY1R.

How does NPY1R signaling in dogs contribute to the regulation of metabolism and obesity?

NPY1R plays a crucial role in metabolic regulation across mammalian species, including dogs. The signaling mechanisms appear to be conserved, with several important observations relevant to canine research:

  • Metabolic phenotypes: While NPY knockout mice show largely normal phenotypes without changes in food intake or obesity, Y1R knockout mice exhibit higher body weights and increased white adipose tissue deposition, suggesting Y1R's critical role in metabolic regulation .

  • Hypothalamic-NAc axis: Y1R expression in the nucleus accumbens (NAc) has been linked to high-fat diet (HFD) intake. Quantitative RT-PCR analysis has shown significantly higher Y1R expression levels in the NAc of HFD-treated mice compared to controls .

  • Pharmacological intervention studies: Y1R antagonist injection into the NAc significantly reduced high-fat diet intake in mice (p = 0.001), while Y1R agonist injection significantly increased HFD intake (p = 0.003) .

For canine studies, researchers should consider:

  • Regional expression patterns: Examine Y1R expression in brain regions associated with feeding behavior in dogs, using quantitative RT-PCR methods similar to those described in rodent studies .

  • Diet-induced changes: Investigate whether high-fat diets alter Y1R expression in dogs as observed in rodent models.

  • Breed-specific variations: Explore potential differences in NPY1R signaling between lean and obesity-prone dog breeds.

Experimental approaches should include both molecular quantification (RT-PCR, Western blot) and functional assessments (feeding behavior following pharmacological manipulation) to establish the role of NPY1R in canine metabolism.

What role does NPY1R play in neurogenesis and neuroprotection, and how can it be targeted therapeutically?

NPY1R has been implicated in adult neuronal proliferation and hippocampal neurogenesis, offering potential therapeutic applications for conditions such as depression, Alzheimer's disease, and schizophrenia . Key findings relevant to canine NPY1R research include:

  • Neurogenesis promotion: Y1R mediates adult neuronal proliferation and hippocampal neurogenesis, suggesting potential application of NPY or Y1R agonists as antidepressants or cognitive enhancers .

  • Neuroprotective effects: NPY signaling through Y1R may exert neuroprotective effects through multiple mechanisms, including modulation of excitotoxicity and neuroinflammation.

  • Anxiolytic effects: Y1R has been implicated in antianxiety behavior in rats, suggesting potential therapeutic applications for anxiety disorders .

For investigating these properties in canine models:

  • Ex vivo neurogenesis assays: Culture dog neural stem cells to assess proliferation and differentiation in response to NPY1R stimulation.

  • In vivo imaging: Use PET imaging with labeled NPY1R ligands to assess receptor distribution and changes in disease models.

  • Behavioral assessments: Evaluate cognitive and anxiety-related behaviors in dogs following administration of NPY1R-targeted compounds.

When designing NPY1R ligands for neurological applications, consider:

  • Blood-brain barrier penetration: Optimize molecular properties to ensure CNS exposure.

  • Receptor selectivity: Distinguish effects mediated by Y1R versus other NPY receptor subtypes.

  • Signaling bias: Develop ligands that preferentially activate neuroprotective pathways over other Y1R-mediated effects.

How can recombinant dog NPY1R be utilized in immunomodulatory research?

NPY has demonstrated significant immunomodulatory properties, particularly in suppressing experimental autoimmune encephalomyelitis (EAE) through Y1R-mediated mechanisms . These findings suggest potential applications for dog NPY1R in veterinary immunology research:

  • T-cell modulation: NPY and Y1R agonists significantly inhibit myelin oligodendrocyte glycoprotein (MOG)-specific Th1 responses and promote a Th2 bias in autoimmune T cells .

  • Direct effects on immune cells: Ex vivo analyses have demonstrated that autoimmune T cells are directly affected by NPY via Y1 receptors .

  • Protective role of endogenous NPY: Treatment with Y1 receptor antagonists induced significantly earlier onset of EAE, indicating a protective role of endogenous NPY in the induction phase of autoimmune disease .

For researchers investigating canine autoimmune conditions:

  • Expression analysis: Use RT-PCR and real-time PCR to quantify Y1R expression in canine immune cells, following protocols similar to those used in murine studies .

  • Functional assays: Assess cytokine profiles (Th1/Th2 balance) in canine lymphocytes following treatment with NPY1R agonists or antagonists.

  • In vivo models: Evaluate the effects of NPY1R modulation in canine models of autoimmune diseases.

When designing immunomodulatory studies targeting dog NPY1R:

  • Cell-specific targeting: Develop approaches to selectively target NPY1R on specific immune cell populations.

  • Combination therapy: Investigate synergistic effects of NPY1R modulation with conventional immunosuppressive agents.

  • Biomarker development: Identify biomarkers that predict responsiveness to NPY1R-targeted immunotherapy.

What are the optimal conditions for solubilizing and purifying recombinant dog NPY1R for structural studies?

Purification of GPCRs like NPY1R for structural studies presents significant challenges due to their hydrophobic nature and instability when removed from the membrane environment. For dog NPY1R purification:

  • Expression system optimization:

    • Add an N-terminal HA signal peptide and Flag epitope tag

    • Replace C-terminal residues with a twin-strep-tag for purification

    • Ensure these modifications maintain receptor functionality through signaling assays

  • Solubilization protocol:

    • Use mild detergents like n-dodecyl-β-D-maltopyranoside (DDM) supplemented with cholesterol hemisuccinate (CHS)

    • Add appropriate ligands during solubilization to stabilize the receptor conformation

    • Maintain reduced temperature (4°C) throughout the purification process

  • Purification strategy:

    • Employ affinity chromatography using the twin-strep-tag

    • Include a size exclusion chromatography step to remove aggregates

    • Consider reconstitution into nanodiscs or lipid cubic phase for structural studies

  • Stabilization approaches:

    • Co-purify with a stabilizing nanobody or high-affinity ligand

    • Consider introducing stabilizing mutations based on homology to thermostabilized human NPY1R constructs

For cryo-EM studies specifically, prepare complexes of dog NPY1R with NPY and G protein (Gi1) to stabilize the active conformation, following approaches successful with human NPY receptors .

What strategies can be employed to improve the expression and functional yield of recombinant dog NPY1R?

Optimizing expression and functional yield of dog NPY1R requires addressing several challenges inherent to GPCR expression:

  • Construct design optimization:

    • Incorporate an N-terminal signal sequence (e.g., HA signal peptide) to enhance membrane trafficking

    • Add affinity tags that don't interfere with function (N-terminal Flag tag, C-terminal twin-strep-tag)

    • Consider codon optimization for the expression system of choice

    • Remove potential glycosylation sites if they affect homogeneity

  • Expression system selection:

    • For functional studies: HEK293 or CHO cells provide appropriate post-translational modifications

    • For structural studies: Insect cell systems (Sf9, High Five) may provide higher yields

    • Stable cell lines under inducible promoters ensure consistent expression levels

  • Culture condition optimization:

    • Temperature reduction during expression (28-30°C) can improve folding

    • Addition of GPCR pharmacoperones or chemical chaperones may enhance functional expression

    • Sodium butyrate treatment can increase expression levels in mammalian systems

  • Co-expression strategies:

    • Co-express with G proteins to stabilize the receptor in a functional conformation

    • Consider co-expression with molecular chaperones to improve folding

  • Functional validation methods:

    • Implement cell-based functional assays to confirm activity of the expressed receptor

    • Use radioligand binding to quantify the proportion of correctly folded receptor

For each modification to improve expression, carefully validate that receptor functionality is maintained through appropriate signaling assays .

How can species differences between canine and human NPY1R be leveraged for selective drug development?

Understanding species differences between canine and human NPY1R offers opportunities for developing species-selective therapeutic agents:

  • Comparative structural analysis:

    • Generate homology models of dog NPY1R based on the human NPY1R structure

    • Identify non-conserved residues in the binding pocket that could be exploited for species selectivity

    • Focus particularly on ECL2 and the extracellular tips of helices V and VI, which form critical interactions with NPY

  • Binding pocket mapping:

    • Perform alanine scanning mutagenesis of predicted dog-specific residues

    • Compare the effects of mutations on binding affinity and functional responses between dog and human NPY1R

    • Use NanoBRET-based binding assays to assess the impact of species-specific mutations on high-affinity binding states

  • Structure-activity relationship studies:

    • Develop NPY analogs with modifications at positions that interact differently with dog versus human NPY1R

    • Test these analogs against both receptor orthologs to identify species-selective ligands

    • Focus on the N-terminal residues of NPY (particularly Y1), which form critical interactions with the receptor

  • Allosteric modulator approach:

    • Screen for compounds that bind to less conserved regions of the receptor

    • Develop positive or negative allosteric modulators that preferentially affect dog NPY1R

When conducting comparative pharmacology studies, ensure consistent experimental conditions (expression levels, assay parameters) to make valid comparisons between species orthologs.

How should researchers design experiments to study the role of NPY1R in canine models of obesity and metabolic disorders?

To effectively investigate NPY1R's role in canine obesity and metabolism, consider the following experimental design approaches:

  • Expression profiling studies:

    • Quantify NPY1R mRNA levels in relevant tissues (hypothalamus, nucleus accumbens, adipose tissue) using quantitative RT-PCR, comparing lean versus obese dogs

    • Perform Western blot analysis to correlate mRNA with protein expression levels

    • Consider single-cell RNA sequencing to identify cell populations expressing NPY1R

  • Diet intervention studies:

    • Design feeding protocols with high-fat diet challenges to assess changes in NPY1R expression

    • Quantify Y1R, Y2R, Y5R, and NPY mRNA levels in relevant brain regions before and after diet intervention

    • Correlate receptor expression changes with metabolic parameters (body weight, adiposity, glucose tolerance)

  • Pharmacological manipulation:

    • Utilize stereotaxic surgery for cannula implantation into specific brain regions (e.g., NAc) for local administration of Y1R antagonists or agonists

    • Measure acute effects on food intake (1-hour HFD intake) and longer-term effects on body weight

    • Include appropriate controls (e.g., standard food intake after fasting) to distinguish effects specific to palatable/high-fat food

  • Breed comparison studies:

    • Compare NPY1R expression and function between obesity-prone and obesity-resistant dog breeds

    • Assess potential polymorphisms in the NPY1R gene that might correlate with metabolic phenotypes

When designing these experiments, include appropriate statistical analyses and sample sizes calculated based on expected effect sizes observed in previous studies of NPY1R in rodent models .

What considerations are important when developing assays to screen for selective dog NPY1R ligands?

Developing effective screening assays for dog NPY1R ligands requires careful consideration of several factors:

  • Primary screening assays:

    • Establish stable cell lines expressing dog NPY1R at physiologically relevant levels

    • Implement multiple readouts to capture different aspects of receptor function:

      • G protein-dependent signaling (cAMP inhibition)

      • β-arrestin recruitment

      • Receptor internalization

    • Include counter-screening against other dog NPY receptor subtypes (Y2R, Y4R, Y5R) to assess selectivity

  • Binding assays:

    • Develop NanoBRET-based binding assays to distinguish high-affinity from low-affinity states

    • Include competition binding studies with labeled NPY to determine binding affinities

    • Consider the influence of G protein coupling on binding characteristics

  • Functional validation:

    • Establish concentration-response relationships for hits in multiple functional assays

    • Assess potential biased signaling properties by comparing efficacy across different pathways

    • Evaluate ligand residence time using kinetic binding assays

  • Structural considerations:

    • Focus on compounds that interact with key residues identified in the NPY binding pocket (D200, D205^5.32, R208^5.35, F286^6.58)

    • Consider the relative positioning of the N and C termini of peptide agonists, which is crucial for recognition between Y1R and NPY

  • Physiological validation:

    • Test selected ligands in ex vivo preparations (e.g., canine tissue slices)

    • Develop translational assays that predict in vivo efficacy

For high-throughput screening campaigns, establish robust Z' factors (>0.5) for all primary assays and include appropriate positive and negative controls to ensure assay quality and reproducibility.

What methodologies are most effective for investigating NPY1R-mediated signaling pathways in canine neural tissues?

Investigating NPY1R signaling in canine neural tissues requires specialized approaches to capture the complexity of neural signaling:

  • Ex vivo electrophysiology:

    • Prepare acute brain slices from relevant regions (hippocampus, amygdala, nucleus accumbens)

    • Utilize whole-cell patch-clamp electrophysiology to assess NPY1R modulation of synaptic transmission

    • Evaluate the effects of selective Y1R agonists and antagonists on neuronal excitability and synaptic plasticity

  • Calcium imaging:

    • Employ fluorescent calcium indicators in primary canine neuronal cultures

    • Measure calcium transients in response to NPY1R activation

    • Distinguish direct effects on neurons versus modulation of neurotransmitter release from terminals

  • Phospho-protein analysis:

    • Utilize phospho-specific antibodies to key signaling molecules in the NPY1R pathway

    • Implement Western blotting or multiplex phospho-protein assays to quantify pathway activation

    • Compare signaling kinetics between different neuronal populations

  • Gene expression regulation:

    • Investigate how NPY1R activation influences gene expression in neural tissues

    • Apply RNA-sequencing to identify regulated genes and pathways

    • Consider the effects of chronic versus acute receptor activation

  • In vivo microdialysis:

    • Measure neurotransmitter release in specific brain regions following NPY1R modulation

    • Correlate neurotransmitter levels with behavioral outcomes

When working with canine neural tissues, establish proper controls for post-mortem changes and consider the regional heterogeneity of NPY1R expression and function across different brain areas. The approach should be informed by findings that NPY receptors are found on excitatory and monoaminergic terminals in regions like the nucleus accumbens .

How can researchers effectively validate the specificity of antibodies for dog NPY1R in immunohistochemical studies?

Antibody validation is critical for reliable immunohistochemical detection of dog NPY1R. A comprehensive validation strategy should include:

  • Positive and negative control tissues:

    • Use tissues with known high expression (e.g., specific brain regions) as positive controls

    • Include tissues from Y1R knockout models (if available) or tissues known to lack Y1R expression as negative controls

    • Compare staining patterns with in situ hybridization data for NPY1R mRNA

  • Recombinant protein controls:

    • Test antibody reactivity against purified recombinant dog NPY1R

    • Perform Western blot analysis to confirm recognition of a band at the expected molecular weight

    • Pre-absorb antibody with the recombinant protein to demonstrate specificity through signal reduction

  • Peptide competition assays:

    • Pre-incubate the antibody with synthetic peptides corresponding to the antigenic epitope

    • Observe elimination or significant reduction of immunostaining as confirmation of specificity

    • Include irrelevant peptides as negative controls for this competition

  • Genetic validation:

    • Implement RNA interference to knock down NPY1R expression in canine cell lines

    • Demonstrate reduced antibody staining in cells with confirmed receptor knockdown

    • Consider using CRISPR-Cas9 gene editing as an alternative validation approach

  • Multiple antibody comparison:

    • Compare staining patterns using different antibodies raised against distinct epitopes

    • Consistent localization patterns increase confidence in antibody specificity

  • Mass spectrometry validation:

    • Perform immunoprecipitation followed by mass spectrometry to confirm the identity of the protein recognized by the antibody

Document validation procedures thoroughly according to guidelines proposed by the International Working Group for Antibody Validation to ensure reproducibility and reliability of immunohistochemical findings.

How should contradictory results in NPY1R functional studies be reconciled and interpreted?

Resolving contradictory results in NPY1R studies requires systematic analysis of experimental variables and biological complexity:

  • Receptor expression level considerations:

    • High overexpression may lead to constitutive activity or atypical signaling

    • Compare results from systems with different expression levels

    • Consider using native tissues alongside recombinant systems

  • G protein coupling heterogeneity:

    • NPY1R can couple to multiple G protein subtypes, potentially with cell-specific preferences

    • Assess G protein expression profiles in different experimental systems

    • Consider that mutations affecting NPY binding may differentially impact various signaling pathways

  • Species and isoform differences:

    • Carefully document the species origin of the NPY1R being studied

    • Note that even small sequence differences between dog and other species can affect pharmacology

    • Consider potential splice variants or post-translationally modified forms

  • Experimental condition variables:

    • Buffer compositions can significantly affect receptor conformation and ligand binding

    • Temperature differences between assays may explain discrepancies

    • Incubation times may reveal kinetic aspects of signaling not apparent in endpoint assays

  • Ligand-specific factors:

    • Different ligands may stabilize distinct receptor conformations (biased signaling)

    • The relative positioning of N and C termini of peptide ligands is crucial for NPY1R recognition

    • Batch-to-batch variability of peptide ligands can contribute to inconsistent results

When faced with contradictory data, systematically test each of these variables while maintaining consistent experimental protocols across comparisons. Consider developing a standardized assay platform that enables direct comparison of results obtained in different laboratories or with different receptor preparations.

What are common pitfalls in recombinant NPY1R expression and functional characterization, and how can they be avoided?

Researchers working with recombinant dog NPY1R should be aware of these common pitfalls and their solutions:

  • Poor expression or misfolding:

    • Pitfall: Low functional receptor yield despite high total expression

    • Solution: Optimize codon usage, incorporate an effective signal sequence, consider lower expression temperatures (28-30°C), and add chemical chaperones during expression

  • Non-specific binding in assays:

    • Pitfall: High background signals in binding assays masking specific interactions

    • Solution: Include appropriate blocking agents, optimize wash protocols, and validate with multiple negative controls including cells lacking NPY1R expression

  • Constitutive activity in highly overexpressing systems:

    • Pitfall: Elevated baseline signaling making agonist responses difficult to detect

    • Solution: Titrate expression levels, use inducible expression systems, and include inverse agonists as controls

  • Receptor desensitization affecting reproducibility:

    • Pitfall: Diminishing responses in repeated measures or time-course experiments

    • Solution: Allow sufficient recovery time between stimulations, include positive controls at regular intervals, and consider using mutants resistant to desensitization for certain applications

  • Inconsistent pharmacology due to G protein availability:

    • Pitfall: Variable potency or efficacy measurements between experiments

    • Solution: Co-express relevant G proteins, standardize cell density and culture conditions, and use stable cell lines rather than transient transfections

  • Artifacts from epitope tags:

    • Pitfall: Tags interfering with ligand binding or signaling

    • Solution: Validate that tagged constructs retain native pharmacology by comparison with untagged receptors where possible

  • Inappropriate data normalization:

    • Pitfall: Masking real effects through improper normalization procedures

    • Solution: Clearly document normalization methods, include raw data in supplementary materials, and ensure controls for each experimental variable

For rigorous characterization, employ multiple orthogonal assays to confirm key findings and include appropriate statistical analyses to distinguish biological variability from experimental artifacts.

How can researchers determine whether the pharmacological properties of recombinant dog NPY1R accurately reflect those of the native receptor?

Validating that recombinant dog NPY1R accurately represents native receptor properties requires multiple complementary approaches:

  • Comparative pharmacology:

    • Test a panel of reference ligands (agonists, antagonists) on both recombinant and native receptors

    • Compare potency (EC50/IC50) and efficacy values between systems

    • Analyze rank order of potency, which should be preserved even if absolute values differ

  • Native tissue validation:

    • Perform functional assays in canine tissue preparations expressing endogenous NPY1R

    • Compare pharmacological profiles with those obtained in recombinant systems

    • Consider regional variations in receptor coupling efficiency or expression of regulatory proteins

  • Signaling pathway analysis:

    • Examine multiple signaling pathways downstream of NPY1R activation

    • Confirm that the pattern of pathway engagement matches between recombinant and native systems

    • Assess biased signaling properties with pathway-specific assays

  • Expression level considerations:

    • Quantify receptor expression levels in both systems using radioligand binding

    • Adjust for expression differences when comparing functional responses

    • Consider implementing inducible expression systems to titrate receptor levels

  • Regulatory protein environment:

    • Identify key regulatory proteins (GRKs, arrestins, RGS proteins) in native tissues

    • Co-express these proteins in recombinant systems if necessary

    • Evaluate the impact of these proteins on receptor pharmacology

  • Post-translational modification analysis:

    • Characterize post-translational modifications (glycosylation, phosphorylation) in native receptors

    • Ensure recombinant expression systems reproduce critical modifications

    • Consider the impact of modifications on ligand binding and signaling properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.