Recombinant Dog Neuropeptide Y receptor type 5 (NPY5R)

Shipped with Ice Packs
In Stock

Description

1.1. Gene and Protein Identity

  • Gene Name: NPY5R (synonyms: NPY5, Y5R, NPYY5-R) .

  • Protein Structure:

    • Amino Acid Sequence: Comprises 446 residues (see for full sequence).

    • Domain Organization: Predicted 7-transmembrane domains characteristic of GPCRs, with extracellular N-terminus and intracellular C-terminus .

    • Homodimerization: NPY receptors, including Y5R, can form homodimers (26–44% efficiency), as shown by fluorescence resonance energy transfer (FRET) studies .

1.2. Functional Role

  • Signaling Pathway: Binds NPY/PYY via its extracellular domain, activating Gαi proteins to inhibit adenylate cyclase and reduce cAMP levels .

  • Physiological Roles:

    • Food Intake Regulation: Y5R agonists stimulate feeding in rodents, though its role in dogs remains under investigation .

    • Cancer Progression: Overexpression in hepatocellular carcinoma (HCC) cells correlates with proliferation and poor prognosis, driven by NPY from peritumorous hepatocytes .

Production and Purification

  • Tagging: May include epitope tags (e.g., Twin-Strep) for purification and detection .

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stored at 4°C for ≤1 week .

3.2. Disease Models

3.3. Drug Development

  • Agonists/Antagonists: Selective Y5R agonists (e.g., chimeric peptides with pancreatic polypeptide segments) show nanomolar affinity and in vivo efficacy .

  • Therapeutic Targets: Y5R inhibitors are explored for obesity and cancer, though clinical trials (e.g., velneperit) have faced challenges .

4.1. ELISA Kits

Recombinant dog NPY5R is used in enzyme-linked immunosorbent assays (ELISA) to quantify receptor levels or ligand binding .

ProductSpecies ReactivityApplications
CSB-CF016037DO (ELISA)DogQuantitative protein detection
ab133757 (Antibody)Human, Dog (predicted)WB, IHC, Flow Cytometry

Data from .

5.1. Cancer-Related Signaling

  • Hepatocellular Carcinoma (HCC):

    • Mechanism: NPY5R on HCC cells binds NPY from peritumorous hepatocytes, activating ERK and Ki-67 pathways .

    • Clinical Relevance: High peritumorous NPY expression correlates with poor survival in HCC patients .

5.2. Behavioral and Metabolic Effects

  • Hyperactivity: Overexpression in mice causes hyperactivity, suggesting a role in locomotor regulation .

  • Species-Specific Roles: Unlike human Y5R, dog NPY5R may not modulate anxiety or depression in rodents .

Challenges and Future Directions

  • Species-Specific Variability: Functional differences between dog and human Y5R necessitate caution in translational studies .

  • Structural Elucidation: Cryo-EM or NMR studies of dog NPY5R are needed to resolve receptor conformational states .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill it.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All protein shipments are made with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
NPY5R; NPY5; Neuropeptide Y receptor type 5; NPY5-R; NPY-Y5 receptor; NPYY5-R; Y5 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MDLELQDFYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNL LILMALMRKRNQKTMVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFL QCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSL VELQETFDSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISC GLSNKENKLEENEMINLTLQPFKKSGPQVKLSSSHKWSYSFIRKHRRRYSKKTACVLPAP ARPPQENHSRMLPENFGSVRSQHSSSSKFIPGVPTCFEVKPEENSDVHDMRVNRSIMRIK KRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCL NPILYGFLNNGIKADLISLIQCLHMS
Uniprot No.

Target Background

Function
Neuropeptide Y receptor type 5 (NPY5R) is a receptor for neuropeptide Y and peptide YY. Its activity is mediated by G proteins that inhibit adenylate cyclase activity. NPY5R is believed to be associated with food intake and may play a role in feeding disorders.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is NPY5R and what are its key physiological functions?

Neuropeptide Y receptor type 5 (NPY5R) is a G-protein coupled receptor that mediates the effects of neuropeptide Y (NPY), one of the most potent stimulants of food intake in mammals. NPY5R plays significant roles in several physiological processes including feeding behavior, energy homeostasis, and neuronal signaling pathways . In the central nervous system, NPY5R has been identified as a potential "feeding receptor" alongside NPY1R, with studies showing that activation of these receptors can stimulate food intake in various mammalian species . Beyond feeding regulation, NPY5R is involved in modulating inhibitory synaptic transmission in neural networks, particularly in cerebellar neurons where it can induce sustained increases in spontaneous GABA release from inhibitory neurons .

How should researchers design appropriate controls when working with recombinant dog NPY5R?

When designing experiments with recombinant dog NPY5R, multiple control strategies should be implemented:

  • Negative Controls: Include samples without the recombinant protein and samples treated with non-specific proteins of similar size and structure.

  • Positive Controls: When using ELISA-based detection methods, incorporate standard curves using purified dog NPY5R protein at known concentrations (0.156-10 ng/mL range is typically suitable) .

  • Specificity Controls: Employ competitive binding assays using known NPY5R ligands to confirm functional integrity.

  • Cross-Reactivity Assessment: Test reactivity with other NPY receptor subtypes (NPY1R, NPY2R) to ensure specificity for NPY5R.

  • Vehicle Controls: For functional assays, include appropriate buffer-only controls that match the protein vehicle composition.

What are the optimal methods for detecting NPY5R expression in canine tissue samples?

Several validated methods can be employed for detecting NPY5R expression in canine tissue samples:

Protein-Level Detection:

  • ELISA: Solid-phase enzyme immunoassays using monoclonal anti-NPY5R antibodies can quantitatively determine NPY5R levels in serum, plasma, cell culture supernatants, body fluids, and tissue homogenates . This method typically has a detection range of 0.156-10 ng/mL with sensitivity around 0.094 ng/mL.

  • Immunohistochemistry: For tissue localization studies, using specific antibodies against dog NPY5R with appropriate fluorescent or enzymatic detection systems.

mRNA-Level Detection:

  • RT-PCR: For detecting NPY5R mRNA expression, particularly useful for comparing expression levels across different tissues or experimental conditions .

  • In Situ Hybridization: For visualizing the distribution of NPY5R mRNA in intact tissue sections.

Each method has specific sample preparation requirements. For protein extraction, tissue homogenization in appropriate buffers containing protease inhibitors is recommended, while RNA isolation requires RNase-free conditions and appropriate stabilization reagents.

What are the recommended storage conditions for maintaining recombinant dog NPY5R stability?

For optimal stability of recombinant dog NPY5R:

  • Short-term Storage (1-2 weeks): Store at 2-8°C in appropriate buffer systems such as PBS with stabilizers .

  • Long-term Storage: Store at -80°C with cryoprotectants such as glycerol (10-20%).

  • Avoid Freeze-Thaw Cycles: Repeated freezing and thawing significantly reduces protein activity; aliquot before freezing .

  • Buffer Considerations: Stability is enhanced in buffers containing:

    • Physiological pH (7.2-7.4)

    • Low concentrations of carrier proteins (0.1-1% BSA)

    • Protease inhibitors

  • Pre-coupled Magnetic Beads: When working with NPY5R pre-coupled to magnetic beads, store at 2-8°C and never freeze, as this can compromise the coupling integrity and bead uniformity .

How can researchers accurately distinguish between NPY1R and NPY5R activation in functional studies?

Distinguishing between NPY1R and NPY5R activation requires a multi-faceted approach:

Pharmacological Approach:

  • Use receptor subtype-selective agonists: NPY5R-selective peptide agonists can activate NPY5R without affecting NPY1R .

  • Apply receptor-selective antagonists sequentially to isolate receptor-specific effects.

  • Design competition assays with increasing concentrations of selective ligands to determine receptor involvement.

Molecular Approach:

  • Implement receptor-specific knockdown strategies using siRNA targeting either NPY1R or NPY5R.

  • Generate cell lines overexpressing only one receptor subtype for comparative studies.

Functional Readout Selection:
Different downstream effects can indicate which receptor is activated:

  • NPY1R activation typically results in transient effects on membrane excitability.

  • NPY5R activation induces sustained increases in spontaneous GABA release and long-term potentiation that cannot be reversed by antagonists once initiated .

CharacteristicNPY1R ActivationNPY5R Activation
Duration of EffectTransientLong-lasting/sustained
Effect on GABA ReleaseSuppressionEnhancement
Response to Antagonist Post-ActivationCan be reversedCannot be reversed once initiated
Location in NeuronsVarious compartmentsPredominantly presynaptic in GABAergic neurons

What experimental designs are most effective for investigating NPY5R involvement in canine feeding behavior?

To investigate NPY5R involvement in canine feeding behavior, consider these experimental approaches:

In Vivo Studies:

  • Intracerebroventricular (ICV) Administration: Infuse NPY or NPY5R-selective agonists directly into the cerebroventricular system followed by detailed assessment of:

    • Food intake at multiple time points (1, 2, 3, 4 hours post-infusion)

    • Eating parameters (time spent eating, meal frequency, meal duration)

    • Food preference when presented with multiple options

  • Comparative Ligand Studies: Administer different NPY fragments and analogs (e.g., PYY, NPY(2-36), NPY(13-36)) to determine receptor subtype involvement through behavioral responses .

Control Measures:

  • Collect and account for food spillage in intake measurements

  • Video record feeding sessions for detailed behavioral analysis

  • Implement Latin square designs for testing multiple compounds with adequate washout periods

Physiological Parameters:

  • Monitor body weight changes

  • Measure metabolic markers before and after NPY5R manipulation

  • Assess effects on meal patterns (categorize meals based on duration: <1 min, 1-5 min, >5 min)

Molecular Validation:

  • Confirm receptor expression in relevant brain regions using immunohistochemistry or in situ hybridization

  • Collect tissue samples post-experiment to correlate behavioral effects with receptor expression levels

How does hypoxia influence NPY5R expression and function, and what methods can detect these changes?

Hypoxia has significant effects on NPY5R expression and function that can be detected and measured through multiple approaches:

Effects of Hypoxia on NPY5R:

  • Hypoxia induces NPY5R mRNA expression in a hypoxia-inducible factor (HIF)-dependent manner .

  • Hypoxic conditions can alter NPY5R signaling dynamics, making cells more responsive to NPY stimulation .

  • The MAPK/ERK pathway is activated more rapidly upon NPY5R stimulation in hypoxic cells compared to normoxic cells .

Methods to Detect Hypoxia-Induced Changes:

  • Transcriptional Analysis:

    • qRT-PCR to quantify changes in NPY5R mRNA expression under normoxic versus hypoxic conditions

    • RNA-Seq to identify broader transcriptional changes in NPY5R signaling pathways

    • Chromatin immunoprecipitation (ChIP) assays to detect HIF binding to NPY5R promoter regions

  • Functional Assays:

    • Proliferation assays to measure enhanced cell growth responses to NPY under hypoxia

    • Migration assays to assess increased motility in response to NPY or Y5-specific agonists

    • Calcium imaging to detect altered signaling kinetics under hypoxic conditions

  • Protein Analysis:

    • Western blotting to measure NPY5R protein levels and phosphorylation states of downstream signaling molecules (ERK1/2)

    • Immunocytochemistry to visualize receptor localization changes under hypoxia

    • Co-immunoprecipitation to identify novel interaction partners in hypoxic conditions

ParameterNormoxic ConditionsHypoxic Conditions
NPY5R mRNA ExpressionBaselineSignificantly increased
MAPK/ERK ActivationSlower, IGF1R-dependentRapid, IGF1R-independent
Proliferative Response to NPYModerateEnhanced
Migration Response to NPYModerateEnhanced
Sensitivity to Y5-specific AgonistsStandardHeightened

What approaches can be used to investigate the potential role of dog NPY5R genetic variants in metabolic disorders?

Investigating the relationship between dog NPY5R genetic variants and metabolic disorders requires a comprehensive approach:

Genetic Screening Methods:

  • Targeted Sequencing: Focus on the NPY5R gene and regulatory regions to identify polymorphisms, insertions, deletions, and splice variants.

  • Genome-Wide Association Studies (GWAS): Identify associations between NPY5R variants and phenotypic traits related to metabolism and feeding behavior.

  • Comparative Genomics: Compare NPY5R sequences across dog breeds with different metabolic profiles and feeding behaviors.

Functional Characterization:

  • In Vitro Receptor Activity Assays: Test variant receptors for:

    • Ligand binding affinity

    • G-protein coupling efficiency

    • Downstream signaling pathway activation

    • Receptor internalization and trafficking

  • Ex Vivo Tissue Studies: Examine receptor expression and function in tissue samples from dogs with different genotypes.

Clinical Correlation:

  • Measure metabolic parameters (glucose tolerance, insulin sensitivity) in dogs with different NPY5R variants

  • Assess food intake patterns and preferences across different genotypes

  • Track long-term weight management and obesity risk

Relevant Data from Human Studies:
Human studies have shown that derived alleles in NPY1R and NPY5R are associated with lower carbohydrate intake, particularly mono- and disaccharides, and these variants may have conferred a survival advantage since the agricultural revolution . These findings suggest that canine NPY5R variants might similarly influence dietary preferences and metabolism.

What methodological challenges exist when comparing NPY5R function across different mammalian species?

Comparative studies of NPY5R across mammalian species face several methodological challenges:

Structural and Functional Variations:

  • Amino acid sequence differences affecting ligand binding sites and G-protein coupling domains

  • Species-specific post-translational modifications altering receptor function

  • The guinea-pig Y5 receptor has higher amino acid identity to the human Y5 receptor than the rat ortholog does, suggesting evolutionary divergence that must be accounted for in comparative studies

Expression Pattern Differences:

  • Tissue distribution variations of NPY5R across species

  • Different relative expression levels of NPY receptor subtypes

  • Species-specific regulatory mechanisms controlling receptor expression

Pharmacological Response Variations:

  • Differential responses to agonists and antagonists

  • Species-specific signaling pathway coupling

  • Varied receptor desensitization and internalization kinetics

Experimental Considerations:

ChallengeMitigation Strategy
Sequence differencesUse species-specific antibodies and ligands
Pharmacological variationsPerform careful dose-response studies for each species
Experimental modelsDevelop appropriate heterologous expression systems
Translational relevanceCorrelate in vitro findings with in vivo physiology

Cross-Species Comparative Approach:

  • Align NPY5R sequences from different species to identify conserved and divergent regions

  • Generate species-specific tools (antibodies, ligands) to ensure accurate detection

  • Employ standardized functional assays applicable across species

  • Consider evolutionary relationships when interpreting data (e.g., guinea pigs are almost equally distantly related to rodents and humans)

What are the best practices for designing and validating NPY5R-targeting immunoassays?

Developing reliable immunoassays for NPY5R requires careful consideration of multiple factors:

Antibody Selection and Validation:

  • Epitope Selection: Target unique, conserved regions of dog NPY5R that don't share homology with other NPY receptors.

  • Specificity Testing: Validate antibodies against recombinant proteins and knockout/knockdown controls.

  • Cross-Reactivity Assessment: Test against other NPY receptor subtypes and closely related GPCRs.

ELISA Development Guidelines:

  • Assay Format Selection: For dog NPY5R, competitive enzyme immunoassay techniques using monoclonal anti-NPY5R antibodies and NPY5R-HRP conjugates have proven effective .

  • Protocol Optimization:

    • Sample incubation: 1 hour at optimal temperature

    • Washing steps: Typically 5 washes to minimize background

    • Substrate reaction: Carefully timed to maximize signal-to-noise ratio

  • Performance Characteristics:

    • Detection range: Typically 0.156-10 ng/mL for NPY5R ELISAs

    • Precision: Intra-assay CV <8%, Inter-assay CV <10%

    • Recovery rates: 80-120% from spiked samples

Sample Preparation Considerations:

  • Serum/plasma: Minimal processing with appropriate anticoagulants

  • Tissue homogenates: Effective protein extraction buffers with protease inhibitors

  • Cell culture: Standardized lysis procedures to ensure consistent protein recovery

How can researchers effectively use NPY5R pre-coupled magnetic beads in experimental workflows?

NPY5R pre-coupled magnetic beads offer versatile applications in research workflows:

Optimal Applications:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation of binding partners

    • Pull-down assays to identify novel interactors

    • Study receptor oligomerization

  • Cell Sorting and Isolation:

    • Selection of NPY5R-expressing cells from mixed populations

    • Isolation of specific neuronal subtypes

  • High-Throughput Screening:

    • Identification of novel ligands

    • Drug candidate screening

    • Automation-compatible formats

Technical Considerations:

  • Bead Handling: Maintain uniform suspension; avoid freezing pre-coupled beads

  • Magnetization Time: Optimize for complete capture without non-specific binding

  • Buffer Selection: Use buffers that maintain protein stability while minimizing non-specific interactions

  • Elution Conditions: Develop conditions that release target molecules without denaturing

Workflow Integration:

  • Sample preparation (standardization of protein concentration)

  • Incubation with pre-coupled beads (optimize time and temperature)

  • Magnetic separation and washing steps

  • Elution of bound molecules

  • Analysis by appropriate downstream techniques (Western blot, mass spectrometry)

How does NPY5R signaling contribute to neural network activity in the cerebellum?

NPY5R plays a unique role in cerebellar neural networks through distinct mechanisms:

Presynaptic Location and Function:

  • NPY5Rs are predominantly located in presynaptic terminals of inhibitory neurons, specifically colocalizing with VGAT (vesicular GABA transporter) .

  • Unlike Y1R and Y2R receptors that transiently suppress inhibitory transmission, Y5R activation triggers a long-lasting increase in spontaneous GABA release from inhibitory neurons .

Signaling Mechanisms:

  • NPY application induces a sustained increase in the frequency of miniature inhibitory postsynaptic currents in stellate cells .

  • The potentiation of inhibitory transmission cannot be reversed by Y5R antagonists once initiated, suggesting the development of long-term potentiation .

Functional Implications:

  • NPY5R activation provides a novel mechanism for modulating inhibitory tone in cerebellar circuits.

  • This sustained enhancement of GABA release likely influences information processing within cerebellar networks.

  • The long-term potentiation character of this effect suggests a role in cerebellar plasticity and learning.

Methodological Approaches for Further Investigation:

  • Electrophysiological recordings to measure inhibitory postsynaptic currents

  • Calcium imaging to visualize presynaptic activity

  • Optogenetic manipulation of specific neural populations

  • Behavioral assays to correlate NPY5R function with cerebellar-dependent behaviors

What evidence connects NPY5R function to evolutionary adaptations in diet and metabolism?

Research provides compelling evidence for NPY5R's evolutionary role in dietary adaptation:

Genetic Evidence:

  • Derived alleles in NPY5R are associated with lower carbohydrate intake, particularly mono- and disaccharides .

  • Carriers of these derived alleles tend to consume meals with lower glycemic index and glycemic load, while showing higher alcohol consumption .

  • These NPY5R variants show hallmarks of recent selection in European populations, suggesting they conferred a survival advantage since the agricultural revolution approximately 11,000 years ago .

Physiological Mechanisms:

  • NPY5R's role in regulating feeding behavior provides a direct link to how genetic variations might influence dietary preferences.

  • The receptor subtype mediates NPY-induced food intake across various mammalian species .

  • Cross-species comparisons show that guinea-pig Y5 receptor has higher amino acid identity to human Y5 than rat Y5 does, indicating differential evolutionary pressures across mammalian lineages .

Health Implications:

Research Directions:

  • Investigate similar variants across diverse human populations with different agricultural histories

  • Examine homologous regions in canine NPY5R genes for evidence of selection pressure in domestication

  • Develop functional assays to determine how these variants alter receptor signaling and downstream metabolic effects

What are the implications of NPY5R expression in cancer biology and potential therapeutic applications?

Recent research has revealed important connections between NPY5R and cancer biology:

Expression Patterns:

  • NPY5R shows elevated expression in multiple cancer types, including breast tumors .

  • This increased expression is being exploited for imaging and diagnostic applications.

Regulation by Tumor Microenvironment:

  • Hypoxia, a common feature in solid tumors, induces NPY5R expression in a HIF-dependent manner .

  • Hypoxic cancer cells demonstrate enhanced proliferation and migration in response to NPY stimulation compared to normoxic cells .

  • Hypoxic cells exhibit a more robust response to Y5-specific agonists, suggesting increased receptor sensitivity .

Signaling Pathway Alterations:

  • The MAPK/ERK pathway is activated more rapidly upon NPY5R stimulation in hypoxic cells.

  • In normoxia, this pathway requires insulin-like growth factor 1 receptor (IGF1R) activity, but hypoxic cells demonstrate IGF1R-independent signaling .

  • Hypoxic cells with induced NPY5R expression show resistance to the radiosensitizer and IGF1R inhibitor AG1024 .

Therapeutic Implications:

  • Targeting Strategy: NPY5R could serve as a biomarker and therapeutic target, particularly for hypoxic regions of tumors.

  • Combination Approaches: Understanding NPY5R's relationship with hypoxia and IGF1R signaling could inform combination therapies.

  • Imaging Applications: The elevated expression could be exploited for developing targeted imaging agents.

Research Considerations:

  • Investigate tissue-specific differences in NPY5R expression across cancer types

  • Develop selective NPY5R antagonists as potential therapeutic agents

  • Explore combination approaches targeting both HIF pathways and NPY5R signaling

How can structural biology approaches enhance our understanding of dog NPY5R function?

Advanced structural biology techniques offer powerful insights into dog NPY5R function:

Current Structural Knowledge Gaps:

  • Limited information on dog-specific structural features of NPY5R

  • Incomplete understanding of how species differences in structure affect ligand binding

  • Unclear conformational changes associated with different functional states

Recommended Structural Biology Approaches:

  • Homology Modeling and Molecular Dynamics:

    • Generate dog NPY5R models based on available GPCR structures

    • Simulate ligand binding events and conformational changes

    • Identify species-specific binding pocket features

  • X-ray Crystallography and Cryo-EM:

    • Determine high-resolution structures of dog NPY5R in different states

    • Co-crystallize with various ligands to understand binding mechanisms

    • Compare with human and rodent structures to identify conserved and divergent features

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry):

    • Map conformational dynamics and ligand-induced changes

    • Identify allosteric networks within the receptor

    • Determine regions involved in G-protein coupling

  • Site-Directed Mutagenesis:

    • Validate structural predictions through functional studies

    • Identify critical residues for species-specific responses

    • Engineer receptors with altered pharmacological profiles

Expected Insights:

  • Detailed understanding of binding modes for different ligands

  • Mechanism of signal transduction through the receptor

  • Structural basis for species differences in pharmacological responses

  • Rational design opportunities for selective ligands

Applications of Structural Knowledge:

  • Design of more selective agonists and antagonists

  • Development of species-specific research tools

  • Enhanced understanding of evolutionary adaptations in receptor function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.