Recombinant Dog Olfactory receptor-like protein OLF3

Shipped with Ice Packs
In Stock

Description

Protein Identity and Classification

Olfactory receptor-like protein OLF3 belongs to the superfamily of G-protein coupled receptors (GPCRs), specifically identified with the UniProt ID Q95156 . The protein is reported to be a synonym of OR2F1 gene product, encoding olfactory receptor family 2 subfamily F member 1 . The canine OLF3 gene is part of a subfamily that ranges from 2 to 20 genes, all of which are expressed in the canine olfactory epithelium .

Expression Systems and Purification

The recombinant form of canine OLF3 is typically expressed in Escherichia coli expression systems, with the full-length protein (amino acids 1-317) fused to an N-terminal histidine tag to facilitate purification . This expression system allows for efficient production of the protein for research and analytical purposes.

Physical and Biochemical Properties

Table 1 summarizes the key properties of recombinant Dog OLF3 protein:

PropertySpecification
SpeciesDog (Canis familiaris)
SourceE. coli
Fusion TagN-terminal His tag
Protein LengthFull Length (1-317)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Molecular Weight~35.4 kDa (based on human homolog)
UniProt IDQ95156

Table 1: Physical and biochemical properties of recombinant Dog OLF3 protein

Olfactory Signal Transduction

Olfactory receptor-like protein OLF3, like other olfactory receptors, plays a fundamental role in the detection of volatile molecules in the air that are perceived as odors by the canine brain . These receptors are expressed on the surface of olfactory sensory neurons in the nasal epithelium . When an odorant molecule binds to the receptor, it triggers a G-protein-mediated signal transduction cascade that ultimately results in the generation of action potentials, conveying the olfactory information to the brain .

Expression Patterns

Studies investigating the expression of canine olfactory receptor genes have revealed that approximately 70% of dog OR genes, including OLF3, are expressed in the olfactory tissues, although at widely varying levels . Interestingly, research has shown that there are substantial differences in gene expression rankings between canine and murine olfactory tissues, suggesting species-specific adaptations in olfactory mechanisms .

Table 2 below illustrates general expression patterns observed in canine olfactory tissues:

ParameterBichonGolden Retriever
Known genes with FPKM > 0.188%90%
Unknown genes with FPKM > 0.162%56%
Highest FPKM62.98052.340

Table 2: Gene expression patterns in canine olfactory tissues

While this table doesn't specifically isolate OLF3 expression, it provides context for the broader expression patterns of olfactory receptor genes in different dog breeds.

Cross-Species Comparison

Olfactory receptors, including OLF3, show significant variation across mammalian species. Research comparing the expression levels of OR genes between dogs and other mammals has noted distinct differences in expression patterns . The human homolog of the canine OLF3 protein has similar structural properties, with 317 amino acid residues and a protein mass of approximately 35.4 kilodaltons .

Breed-Specific Variations

Dogs exhibit remarkable variation in olfactory capabilities across different breeds, particularly those selectively bred for hunting or scent detection . This variation may be attributed to differences in olfactory gene expression levels and polymorphisms. The genetic diversity within OR genes, including OLF3, potentially contributes to the distinct olfactory capabilities observed across different canine breeds . Further research is needed to fully characterize how OLF3 expression and structure may vary across breeds with different olfactory specializations.

Antibodies and Detection Methods

For research purposes, anti-OLF3 antibodies have been developed to detect and measure the OLF3 antigen in biological samples . These antibodies are suitable for various applications including Western blot and ELISA techniques, enabling researchers to investigate OLF3 expression and function .

Sample Collection Methods

A significant advancement in canine olfactory research has been the development of non-aggressive methods to recover olfactory sensory neuron samples from living animals . This approach allows for analysis of dog OR RNA profiling across many dogs and breeds, facilitating documentation of variation influenced by environmental factors or life experiences .

Recombinant Protein Applications

The availability of recombinant Dog OLF3 protein provides researchers with valuable tools for studying:

  1. Ligand-binding properties of canine olfactory receptors

  2. Structure-function relationships in olfactory signal transduction

  3. Comparative studies across different canine breeds and other mammalian species

  4. Development of biosensors and artificial olfactory systems

Expanding Knowledge on OLF3 Function

Despite the progress made in characterizing the OLF3 protein, several aspects require further investigation. The specific odorants that activate OLF3 remain largely unknown, and the downstream signaling pathways associated with OLF3 activation need more detailed characterization .

Breed-Specific Studies

The exceptional olfactory capabilities of certain dog breeds used for detection of drugs, explosives, or diseases presents an important avenue for research . Comparative studies across different dog breeds could provide valuable insights into the relationship between OLF3 expression patterns, genetic polymorphisms, and functional olfactory capabilities .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Olfactory receptor-like protein OLF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Protein Sequence
MGTGNQTWVREFVLLGLSSDWDTEVSLFVLFLITYMVTVLGNFLIILLIRLDSRLHTPMY FFLTNLSLVDVSYATSIIPQMLAHLLAAHKAIPFVSCAAQLFFSLGLGGIEFVLLAVMAY DRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLMQTVITFQLPMCTNKYIDHISCE LLAVVRLACVDTSSNEIAIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSTEGRKKAFHT CASHLTVVVLCYGMAIFTYIQPRSSPSVLQEKLISLFYSVLTPMLNPMIYSVRNKEVKGA WQKLLGQLTGITSKLAT
Uniprot No.

Target Background

Function
Putative odorant or sperm cell receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of canine olfactory receptor genes including OLF3?

Canine olfactory receptor genes, including OLF3, are organized into distinct subfamilies that can have as few as 2 members or as many as 20 members. Analysis using Southern blot hybridization experiments has revealed that:

  • Subfamily members are typically clustered together in the genome

  • Multiple subfamilies may be closely linked, as demonstrated with pulsed-field gel analysis

  • Most or all cross-hybridizing bands in genomic Southern blots represent actively transcribed olfactory receptor genes

  • The predicted proteins share approximately 40-64% identity with previously identified olfactory receptors

Interestingly, studies across 26 different dog breeds have shown that the number of genes per subfamily remains remarkably stable despite selective breeding for different olfactory capabilities in scent hounds, sight hounds, and toy breeds .

How is OLF3 expressed in canine olfactory systems, and what techniques are optimal for studying its expression?

OLF3 is exclusively expressed in olfactory epithelium, consistent with other canine olfactory receptor genes. The recommended methodology for studying OLF3 expression includes:

  • RNA extraction and RT-PCR: Using tissue-specific primers designed from the OLF3 sequence for confirming expression patterns

  • In situ hybridization: For visualizing spatial expression within the olfactory epithelium

  • Southern hybridization: To identify cross-hybridizing subfamily members

  • Pulsed-field gel analysis: For studying genomic organization of OLF3 and related receptor genes

These techniques have revealed that multiple members of larger subfamilies are actively expressed, suggesting functional redundancy or specialization within the olfactory system .

What is currently understood about the functional role of OLF3 in the olfactory signal transduction pathway?

OLF3 functions as part of the initial odorant recognition machinery in the complex process of canine olfaction. The olfactory process involving OLF3 can be broken down into several stages:

  • Initial recognition: OLF3, like other olfactory receptors, is involved in the chemical binding of odorant molecules following sniffing, which brings odorants to the mucus layer covering the olfactory epithelium .

  • Signal transduction: Upon odorant binding, OLF3 likely initiates an intracellular cascade involving G-protein-dependent adenylyl cyclase production of second messenger molecules, leading to the opening of ion channels and generation of action potentials in olfactory receptor neurons (ORNs) .

  • Signal propagation: The signal generated is transmitted from the ORNs to the olfactory bulb and subsequently to regions including the pyriform cortex, periamygdaloid cortex, entorhinal cortex, thalamus, and frontal cortex, where recognition and interpretation occur .

The efficiency of this process is concentration-dependent, with detection accuracy restricted by the concentration of odorants present in the environment .

What experimental designs are most effective for studying OLF3 interactions with odorant molecules?

When studying OLF3 interactions with odorant molecules, researchers should consider these methodological approaches:

  • In vitro binding assays: Using purified recombinant OLF3 to measure direct binding kinetics with various odorants

  • Calcium imaging: To measure receptor activation following odorant exposure

  • Electrophysiological methods: Including electro-olfactogram (EOG) measurements, which have shown that a 10-fold increase in odorant concentration corresponds to approximately a 3-fold increase in response amplitude

  • Cell-based reporter assays: Heterologous expression systems with coupled reporter genes to quantify receptor activation

  • Computational modeling: Molecular docking studies to predict binding sites and affinities

When designing experiments, researchers should note that detection thresholds are highly concentration-dependent, and the presence of zinc nanoparticles has been shown to enhance odorant responses, potentially equivalent to a 10-fold increase in odor concentration .

How can zinc nanoparticles be utilized in OLF3 research protocols?

Research has demonstrated that zinc nanoparticles can significantly enhance olfactory function in dogs. When incorporating zinc nanoparticles into OLF3 research protocols, consider:

  • Preparation method: Zinc nanoparticles can be suspended in water vapor for delivery during olfactory experiments

  • Enhanced connectivity: fMRI studies have shown that zinc nanoparticles up-regulate directional brain connectivity in parts of the canine olfactory network

  • Quantifiable enhancement: Adding zinc nanoparticles to odorants has been shown to:

    • Increase the spatial extent of activated brain regions by approximately 2-fold

    • Produce a 3-fold shift to larger values of connectivity in pathways belonging to the canine olfactory network

    • Create effects equivalent to a 10-fold increase in odor concentration

  • Control conditions: Proper experimental design should include:

    • Odorant alone

    • Odorant with zinc nanoparticles

    • Water vapor with zinc nanoparticles

    • Water vapor alone

This approach allows for isolation of specific effects of zinc nanoparticles on OLF3 function .

What techniques are available for studying the structural biology of OLF3 and how do they inform ligand binding studies?

Advanced structural biology techniques for studying OLF3 include:

  • X-ray crystallography: While challenging for membrane proteins like olfactory receptors, this method can provide atomic-level resolution of protein structure.

  • Cryo-electron microscopy (Cryo-EM): Increasingly useful for determining membrane protein structures without crystallization.

  • Nuclear Magnetic Resonance (NMR) spectroscopy: Particularly useful for studying dynamics of ligand binding.

  • Molecular dynamics simulations: Complementary to experimental approaches, providing insights into binding pocket dynamics and conformational changes upon ligand binding.

  • Site-directed mutagenesis: Systematic modification of specific amino acid residues to identify critical binding sites.

When interpreting structural data, researchers should consider that OLF3 likely follows the general structural pattern of G-protein coupled receptors with seven transmembrane domains, with the ligand binding pocket typically formed within these transmembrane regions .

How does OLF3 compare across different canine breeds and what are the implications for comparative genomics studies?

Analysis of olfactory receptor gene subfamilies across 26 different dog breeds has provided evidence that the number of genes per subfamily remains relatively stable despite differential selection for olfactory acuity in scent hounds, sight hounds, and toy breeds . This has several implications for comparative genomics studies:

  • Conservation vs. specialization: The stability in gene numbers suggests strong evolutionary conservation, though expression levels or single nucleotide polymorphisms might account for functional differences.

  • Methodological approach: Comparative studies should:

    • Use consistent sampling methods across breeds

    • Account for potential epigenetic regulation

    • Consider both genomic organization and expression levels

    • Integrate data from different breeds and wild canids for evolutionary context

  • Functional redundancy: The clustering of subfamily members in the genome suggests potential for coordinated regulation or functional redundancy.

These findings challenge simplistic assumptions about genetic differences underlying olfactory performance variations between breeds and suggest more complex regulatory mechanisms may be at play .

What are the optimal conditions for working with recombinant OLF3 protein in laboratory settings?

Based on available data, recombinant OLF3 protein should be handled according to these guidelines:

ParameterRecommended ConditionNotes
Storage temperature-20°C (short term), -80°C (long term)Avoid repeated freeze-thaw cycles
Working aliquotsStore at 4°CFor up to one week
Buffer compositionTris-based buffer with 50% glycerolOptimized for protein stability
Purification tagHistidine tagMost common for recombinant versions
Expression systemE. coliFor full-length protein production

For experimental work, researchers should consider:

  • Maintaining protein solubility through appropriate detergents or membrane-mimetic systems

  • Verifying protein folding and activity before experimental use

  • Using freshly prepared aliquots for critical experiments

How can functional neuroimaging techniques be applied to study OLF3's role in the canine olfactory network?

Functional neuroimaging techniques have proven valuable in understanding the broader olfactory network in which OLF3 functions. Key methodological considerations include:

  • fMRI study design:

    • Use of awake, unrestrained dogs to avoid anesthesia effects on olfactory processing

    • Controlled odorant delivery systems with and without enhancers (e.g., zinc nanoparticles)

    • Careful baseline establishment using water vapor controls

    • Concentration-dependent paradigms to establish dose-response relationships

  • Connectivity analysis approaches:

    • Directional connectivity measures between regions of the olfactory network

    • Cumulative frequency distribution analysis of mean connectivity values

    • Comparisons across different experimental conditions (odorant alone, odorant with zinc nanoparticles, etc.)

  • Key findings from previous studies:

    • A 10-fold increase in odorant concentration causes approximately a doubling in spatial extent of activation

    • Addition of zinc nanoparticles to odorants increases spatial extent of activated regions by approximately 2-fold

    • Zinc nanoparticles produce a 3-fold shift to larger values of connectivity in olfactory network pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.