Recombinant Dog Olfactory receptor-like protein OLF4

Shipped with Ice Packs
In Stock

Description

Gene Structure and Evolution

  • OLF4 belongs to one of four olfactory receptor (OR) subfamilies (OLF1–OLF4) identified in dogs .

  • These genes lack introns, enabling efficient recombinant expression .

  • Subfamilies OLF1–OLF4 are clustered in the canine genome, with OLF1 and OLF2 tightly linked .

Expression and Tissue Specificity

  • OLF4 is expressed exclusively in canine olfactory epithelium, with no detectable expression in non-olfactory tissues (e.g., liver, spleen) .

  • Transcriptomic studies using nasal epithelial samples revealed that only 14–16% of OR genes, including OLF4, are expressed at detectable levels (FPKM > 0.1) .

Breed-Specific Stability

  • Analysis across 26 dog breeds (e.g., scent hounds, toy breeds) showed stable OLF4 subfamily gene counts despite selective breeding for olfactory acuity .

Functional Studies

  • Ligand Specificity: OLF4’s variable ligand-binding site allows recognition of diverse odorants, enabling research into odor discrimination mechanisms .

  • Signal Transduction: The protein interacts with Gα subunits (e.g., Gα<sub>olf</sub>) to activate cAMP-mediated pathways, though GNAL (encoding Gα<sub>olf</sub>) showed low expression in canine olfactory neurons .

Technical Challenges

  • Sample Contamination: Canine olfactory neuron samples often contain non-neuronal cells, diluting OR-specific transcripts like OLF4 .

  • Low Expression Levels: Deep sequencing of nasal epithelium revealed OLF4 transcripts at lower abundances compared to murine ORs .

Cross-Species Homology

  • Human homologs of OLF4 map to chromosome 19p13.1–13.2, but functional studies remain limited .

  • In mice, ORs are more abundantly expressed (90% FPKM > 0.1), highlighting species-specific differences .

Evolutionary Conservation

  • Olfactory receptor families expanded through chromosomal duplications, with ORs constituting ~1,000 genes in mammals .

  • Dogs retain a high pseudogene fraction (72% in humans), but OLF4 subfamily members remain transcriptionally active .

Recombinant Production

  • Suppliers like Creative BioMart and Cusabio offer OLF4 as lyophilized protein for in vitro studies .

Therapeutic Prospects

  • OLF4 could aid in restoring olfaction in sensorineural disorders via basal cell gene therapy, though this remains speculative .

Future Directions

  • High-Resolution Structural Studies: Cryo-EM or X-ray crystallography to map OLF4’s ligand-binding pocket.

  • Breed-Specific Profiling: Correlate OLF4 expression levels with olfactory performance across working dog breeds.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you require a specific format, please specify your preference when placing the order. We will fulfill your request accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfactory receptor-like protein OLF4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Protein Sequence
MELENDTRIPEFLLLGFSEEPKLQPFLFGLFLSMYLVTILGNLLLILAVSSDSHLHTPMY FFLANLSFVDICFTCTTIPKMLVNIQTQRKVITYESCIIQMYFFELFAGIDNFLLTVMAY DRYMAICYPLHYMVIMNPQLCSLLLLVSWIMSALHSLLQTLMVLRLSFCTHFQIPHFFCE LNQMIQLACSDTFLNNMMLYFAAILLGVAPLVGVLYSYFKIVSSIRGISSAHSKYKAFST CASHLSVVSLFYCTSLGVYLSSAAPQSTHTSSVASVMYTVVTPMLNPFIYSLRNKDIKGA LNVFFRGKP
Uniprot No.

Target Background

Function
Putative odorant or sperm cell receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is dog olfactory receptor-like protein OLF4 and what is its role in canine olfaction?

Dog olfactory receptor-like protein OLF4 (UniProt ID: Q95157) is a member of the G protein-coupled receptor superfamily that plays a critical role in the canine olfactory system. It is expressed exclusively in olfactory epithelium and is involved in the initial recognition of odorant molecules . As part of the olfactory receptor gene family, OLF4 contributes to the dog's remarkable scenting abilities by participating in the conversion of chemical stimuli into electrical signals that can be processed by the brain.

How is OLF4 organized within the canine genome compared to other olfactory receptors?

Canine olfactory receptor genes, including OLF4, are organized into subfamilies within the genome. Analysis using Southern blots of pulsed-field gels has demonstrated that members of these subfamilies are clustered together, with some subfamilies being closely linked . The four identified subfamilies have varying numbers of members, ranging from as few as 2 to as many as 20 . This genomic organization is significant for understanding the evolution and regulation of olfactory receptors in dogs.

What expression systems are most effective for producing recombinant dog OLF4?

Optimization StrategyImplementation DetailsConsiderations
Temperature controlLower induction temperature (15-25°C)Reduces inclusion body formation
Specialized strainsC41(DE3), C43(DE3), or Rosetta strainsEnhances membrane protein expression
Fusion partnersHis tag (documented) , MBP, or SUMOImproves solubility and purification
Induction conditionsLow IPTG concentration (0.1-0.5 mM)Controls expression rate

For applications requiring post-translational modifications, alternative systems such as insect cells (Sf9/Sf21) or mammalian cells (HEK293) might be considered, though successful E. coli expression indicates this system may be sufficient for many research purposes .

What purification methods yield the highest purity of recombinant OLF4?

For His-tagged recombinant dog OLF4, the following purification strategy can achieve greater than 90% purity :

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin as the primary capture step

  • Buffer optimization with appropriate detergents to maintain membrane protein solubility

  • Size exclusion chromatography as a polishing step to remove aggregates and obtain homogeneous protein

  • Quality control via SDS-PAGE to confirm purity

Careful attention to detergent selection is critical throughout the purification process, as inappropriate detergent concentrations may lead to protein aggregation or denaturation.

What are the optimal storage conditions for maintaining OLF4 stability?

Based on the available information, the following storage recommendations maximize stability of recombinant dog OLF4 :

  • Store lyophilized powder at -20°C or -80°C upon receipt

  • After reconstitution in deionized sterile water (0.1-1.0 mg/mL), store working aliquots at 4°C for up to one week

  • For long-term storage, add glycerol (5-50% final concentration, with 50% being recommended) and store at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles, as these significantly reduce protein stability

  • Storage buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Adhering to these storage guidelines is essential for maintaining protein integrity and functional activity.

How does OLF4 vary across different dog breeds with varying olfactory abilities?

While specific information about OLF4 variation across breeds is limited, analysis of olfactory receptor gene subfamilies across 26 different dog breeds has provided valuable insights. Interestingly, the number of genes per olfactory receptor subfamily appears to be stable despite different selective pressures for olfactory acuity in scent hounds, sight hounds, and toy breeds . This stability suggests that:

  • The core structure and function of olfactory receptors like OLF4 may be conserved across breeds

  • Differences in olfactory abilities might result from:

    • Regulatory variations affecting expression levels

    • Subtle sequence variations affecting ligand specificity

    • Differences in signal processing at higher brain centers

    • Variations in other components of the olfactory system

Further research specifically targeting OLF4 across breeds would provide valuable insights into whether its sequence or expression correlates with known differences in scenting ability.

How does canine OLF4 compare to olfactory receptors in other species?

Comparative analysis indicates that dog olfactory receptors, including OLF4, share 40-64% sequence identity with previously identified olfactory receptors from other species . This moderate level of conservation suggests:

  • Retention of core functional domains necessary for G protein coupling and signal transduction

  • Divergence in regions likely involved in ligand recognition

  • Species-specific adaptations that may reflect ecological niche specialization

Investigating the specific differences between dog OLF4 and its orthologs in other canids or more distant mammalian species could provide insights into the molecular basis of species-specific olfactory capabilities.

What evolutionary processes have shaped OLF4 in the canine genome?

The genomic organization of olfactory receptor genes, with subfamily members clustered together , provides clues about evolutionary processes. These may include:

  • Gene duplication events followed by subfunctionalization

  • Concerted evolution maintaining sequence similarity within subfamilies

  • Selection pressures during domestication and breed development

  • Maintenance of functional diversity to detect a wide range of odorants

The stability of olfactory receptor gene numbers across breeds with different olfactory abilities suggests that evolutionary changes in regulatory elements rather than gene gain/loss events may underlie breed-specific olfactory phenotypes.

What functional assays can be employed to study OLF4 ligand interactions?

Several methodologies can be utilized to investigate the ligand interactions of dog OLF4:

Assay TypeMethodologyData OutputAdvantages
Calcium mobilizationHeterologous expression with calcium indicatorsFluorescence changes upon receptor activationReal-time monitoring, high throughput capability
BRET/FRETEnergy transfer between receptor and signaling proteinsConformational change measurementLive-cell analysis, minimal interference
cAMP accumulationELISA or FRET-based cAMP sensorsQuantification of second messengerMeasures downstream signaling
GTPγS bindingRadioligand binding assayG protein activation measurementDirect measure of G protein coupling
Surface plasmon resonanceImmobilized receptor with flowing ligandsBinding kinetics and affinityLabel-free, real-time binding analysis

These complementary approaches can provide comprehensive characterization of OLF4-ligand interactions and subsequent signaling events.

How can recombinant OLF4 be incorporated into structural studies?

Structural characterization of membrane proteins like OLF4 presents significant challenges. The following approaches may be considered:

  • X-ray crystallography:

    • Protein stabilization in detergent micelles or lipidic cubic phases

    • Thermostabilizing mutations to enhance crystallization propensity

    • Use of antibody fragments as crystallization chaperones

  • Cryo-electron microscopy:

    • Reconstitution into nanodiscs or amphipols

    • Potentially feasible for OLF4 without crystallization

  • NMR spectroscopy:

    • Isotopic labeling of recombinant OLF4

    • Suitable for studying ligand binding and dynamics

  • Computational approaches:

    • Homology modeling based on related GPCR structures

    • Molecular dynamics simulations of OLF4-ligand interactions

Each method offers unique advantages and limitations, and a combination of approaches may provide the most comprehensive structural insights.

What strategies can be employed to study OLF4 expression patterns in canine olfactory epithelium?

To investigate the expression patterns of OLF4 in native canine tissues:

  • Nucleic acid-based methods:

    • Quantitative PCR to measure expression levels

    • RNA in situ hybridization to visualize spatial distribution

    • Single-cell RNA sequencing to identify cell-specific expression patterns

  • Protein-based methods:

    • Development of specific antibodies against unique OLF4 epitopes

    • Immunohistochemistry or immunofluorescence microscopy

    • Flow cytometry of dissociated olfactory epithelial cells

  • Functional mapping:

    • Calcium imaging in tissue slices with specific odorants

    • Electrophysiological recordings from identified neurons

These approaches would provide complementary information about the distribution and regulation of OLF4 in canine olfactory tissues.

How can recombinant OLF4 be utilized in developing olfaction-based diagnostic tools for canine diseases?

Recombinant OLF4 could serve as a platform for developing novel diagnostic applications:

  • Biomarker detection:

    • Designing biosensors incorporating OLF4 for detecting disease-specific volatile compounds

    • Creating OLF4-based cell lines as screening tools for disease biomarkers

  • Comparative studies:

    • Analyzing OLF4 function in healthy dogs versus those with olfactory impairments

    • Investigating correlations between OLF4 genetic variations and specific disease susceptibilities

  • Diagnostics development:

    • Engineering OLF4-based detection systems for environmental toxins relevant to canine health

    • Creating portable sensing devices incorporating reconstituted OLF4 for field diagnostics

These applications could advance both veterinary medicine and our understanding of olfactory receptor biology.

What approaches can resolve contradictory data regarding OLF4 function across different experimental systems?

When confronted with conflicting experimental results regarding OLF4 function, researchers should consider:

  • System-specific variables:

    • Expression system differences (E. coli vs. mammalian cells)

    • Influence of tag position and identity on protein function

    • Membrane composition effects on receptor conformation and activity

  • Methodological reconciliation:

    • Direct comparison of experimental conditions

    • Standardization of key parameters (temperature, pH, ionic composition)

    • Multi-laboratory validation studies

  • Integrated analysis:

    • Correlation of in vitro findings with ex vivo and in vivo observations

    • Development of mathematical models to explain apparently contradictory results

    • Meta-analysis of existing datasets to identify consistent patterns

  • Advanced techniques:

    • Single-molecule analysis to identify receptor subpopulations

    • Time-resolved measurements to capture transient states

These approaches can help resolve contradictions and develop more comprehensive models of OLF4 function.

How might CRISPR/Cas9 genome editing be applied to study OLF4 function in canine models?

CRISPR/Cas9 technology offers powerful approaches for investigating OLF4 function:

  • Gene modification strategies:

    • Precise knockin of reporter tags to monitor endogenous OLF4 expression

    • Introduction of specific mutations to assess structure-function relationships

    • Creation of conditional knockout models to study OLF4 role in development and adult function

  • Regulatory element analysis:

    • Targeted modification of OLF4 promoter or enhancer regions

    • Creation of breed-specific regulatory variants to study expression differences

  • Methodological considerations:

    • Delivery methods for canine olfactory epithelium (viral vectors, electroporation)

    • Verification strategies (sequencing, functional assays)

    • Ethical considerations for canine genome editing

  • Potential applications:

    • Creation of reporter systems for real-time monitoring of OLF4 activation

    • Engineering enhanced or modified olfactory functions for working dogs

These genomic approaches could significantly advance our understanding of OLF4 biology and function.

What are the critical quality control parameters for recombinant OLF4 preparations?

To ensure reliability and reproducibility in experiments using recombinant OLF4, researchers should evaluate:

Quality ParameterMethodAcceptance CriteriaImportance
PuritySDS-PAGE, HPLC>90% purity Prevents interference from contaminants
IdentityMass spectrometry, Western blotConfirmation of sequence and molecular weightVerifies correct protein expression
IntegritySDS-PAGE, Western blotMinimal degradation productsEnsures functional protein
Folding/StructureCircular dichroism, fluorescence spectroscopySecondary structure consistent with GPCRsCritical for functional studies
ActivityLigand binding or functional assaysConcentration-dependent responseConfirms biological activity
Endotoxin levelsLAL assay<1 EU/mg for cell-based assaysPrevents non-specific effects

Regular monitoring of these parameters is essential, particularly across different batches of recombinant protein.

What are common challenges in working with OLF4 and how can they be addressed?

Researchers working with OLF4 may encounter several challenges:

  • Expression and solubility issues:

    • Challenge: Low yields or inclusion body formation

    • Solution: Optimize expression conditions (temperature, inducer concentration); use specialized strains; add solubilizing tags

  • Protein stability problems:

    • Challenge: Aggregation or degradation during storage

    • Solution: Include stabilizing agents (trehalose , glycerol); optimize buffer composition; store as recommended at -20°C/-80°C

  • Functional variability:

    • Challenge: Inconsistent activity in functional assays

    • Solution: Standardize protein:lipid ratios; control for oxidation; ensure proper refolding

  • Ligand identification difficulties:

    • Challenge: Unknown or disputed ligand specificity

    • Solution: Employ broad screening approaches; validate with multiple assay formats; consider receptor heterogeneity

  • Antibody cross-reactivity:

    • Challenge: Limited availability of specific antibodies

    • Solution: Utilize epitope tags ; develop custom antibodies against unique epitopes; validate specificity extensively

Addressing these challenges requires systematic optimization and careful experimental design.

How can researchers validate that recombinant OLF4 maintains native-like properties?

Validation of native-like properties is essential for meaningful experimental outcomes:

  • Structural comparisons:

    • Secondary structure analysis (CD spectroscopy)

    • Thermal stability assessment compared to native membrane preparations

    • Lipid interaction profiles

  • Functional validation:

    • Ligand binding profile comparison with native receptors

    • G protein coupling specificity assessment

    • Signaling kinetics evaluation

  • Comparative approaches:

    • Side-by-side testing with native receptors when possible

    • Correlation of in vitro findings with ex vivo observations

    • Cross-validation across multiple experimental systems

  • Controls and standards:

    • Inclusion of well-characterized control receptors

    • Benchmarking against established receptor paradigms

    • Development of internal reference standards

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.