Recombinant Dog Oligosaccharyltransferase complex subunit OSTC (OSTC)

What is the basic structure and function of dog OSTC protein?

Dog Oligosaccharyltransferase complex subunit OSTC is a 149 amino acid protein that functions as a non-catalytic component of the oligosaccharyltransferase (OST) complex. The protein is encoded by the OSTC gene with UniProt ID P86218 . OSTC is specifically involved in the STT3A-containing form of the oligosaccharyl transferase complex which catalyzes the initial transfer of defined glycan structures (typically Glc₃Man₉GlcNAc₂ in eukaryotes) from lipid carrier dolichol-pyrophosphate to asparagine residues within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains . This represents the critical first step in protein N-glycosylation which occurs cotranslationally as polypeptides are being synthesized and threaded through the translocon complex at the endoplasmic reticulum membrane .

How is recombinant dog OSTC typically produced for research purposes?

Recombinant full-length dog OSTC can be produced using bacterial expression systems, particularly E. coli. The common methodology involves generating a construct containing the complete coding sequence (amino acids 1-149) fused to an N-terminal His-tag to facilitate purification . The protein is typically recovered in lyophilized powder form with greater than 90% purity as determined by SDS-PAGE . The amino acid sequence is: METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG . For optimal research applications, the lyophilized protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What are the common synonyms and identifiers for dog OSTC in research literature?

When conducting literature searches, researchers should be aware of several synonyms for OSTC that may appear in publications, including: DC2, DC2 protein, and hydrophobic protein HSF-28 . The official full name is oligosaccharyltransferase complex subunit . For database searches, the UniProt ID P86218 is the primary identifier for canine OSTC . It's important not to confuse this protein with OSTC as used in some clinical literature, where it may refer to the "Osteoporosis Self-Assessment Tool for Chinese," which is a completely unrelated screening tool used in osteoporosis research .

What is the membrane topology of dog OSTC and how does it relate to function?

Dog OSTC is a highly hydrophobic membrane protein with multiple transmembrane domains, as evidenced by its amino acid sequence which shows several hydrophobic regions . The protein contains 149 amino acids with a sequence that suggests integration into the endoplasmic reticulum membrane. Analysis of the amino acid sequence (METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG) reveals hydrophobic stretches consistent with transmembrane domains . Functionally, this membrane integration is crucial as it allows OSTC to associate with other OST complex components and position itself correctly at the ER membrane where it interacts with the Sec61 translocon complex . This positioning enables the OST complex to access nascent polypeptides as they emerge from the ribosome into the ER lumen, facilitating the cotranslational N-glycosylation process essential for proper protein folding and function.

How does dog OSTC interact with other components of the oligosaccharyltransferase complex?

Dog OSTC functions as a specific component of the STT3A-containing form of the oligosaccharyl transferase (OST) complex . While the search results don't provide specific details about dog OSTC interactions, comparative analysis with human OSTC suggests it likely integrates into a multi-subunit complex that includes STT3A (the catalytic subunit), RPN1, RPN2, DDOST, DAD1, and several other proteins. OSTC likely contributes to the structural integrity of the OST complex rather than providing direct catalytic activity, as indicated by its classification as a "non-catalytic subunit" . The complex associates with the Sec61 complex at the channel-forming translocon that mediates protein translocation across the endoplasmic reticulum. Research indicates that all subunits, including OSTC, are required for maximal enzymatic activity of the complex, suggesting cooperative functionality between components .

What are the optimal buffer conditions for functional studies of recombinant dog OSTC?

For functional studies of recombinant dog OSTC, the protein is typically maintained in Tris/PBS-based buffer at pH 8.0 containing 6% trehalose as a stabilizer . When reconstituting lyophilized OSTC protein, researchers should use deionized sterile water to achieve concentrations of 0.1-1.0 mg/mL . For long-term storage and to maintain protein stability, addition of glycerol to a final concentration of 5-50% (with 50% being commonly used) is recommended before aliquoting and storing at -20°C/-80°C . Repeated freeze-thaw cycles should be strictly avoided to prevent protein degradation and loss of functional integrity . For working aliquots, storage at 4°C for up to one week is suggested . When designing functional assays, researchers should consider that as a membrane protein, OSTC may require detergent or lipid reconstitution systems to maintain its native conformation and activity, though specific detergent recommendations are not provided in the search results.

How can researchers verify the activity of recombinant dog OSTC in vitro?

Verifying the activity of recombinant dog OSTC presents a challenge as it is a non-catalytic subunit that functions as part of a multi-protein complex. Unlike enzymes with direct measurable catalytic activity, OSTC's functionality must be assessed in the context of the complete oligosaccharyltransferase complex. Researchers could employ several approaches:

• Reconstitution assays: Combining recombinant dog OSTC with other purified OST components (particularly STT3A) to reconstitute the complex in vitro, followed by measuring N-glycosylation activity using fluorescently labeled peptide substrates containing the Asn-X-Ser/Thr motif.

• Protein-protein interaction studies: Using techniques such as co-immunoprecipitation, pull-down assays, or surface plasmon resonance to verify OSTC's ability to interact with other OST components, particularly STT3A.

• Complementation studies: Introducing recombinant dog OSTC into OSTC-deficient cell lines and measuring restoration of N-glycosylation activity.

• Structural integrity assessment: Using circular dichroism or limited proteolysis to ensure the recombinant protein has folded properly, particularly important for membrane proteins expressed in bacterial systems.

Results should be compared with positive controls (such as native OST complex) to validate functional activity.

What cellular models are appropriate for studying dog OSTC function?

• Canine cell lines: Primary cell lines derived from dog tissues or established canine cell lines (such as MDCK - Madin-Darby Canine Kidney cells) would provide the most relevant cellular context for studying native dog OSTC function.

• OSTC knockout/knockdown systems: Generating CRISPR/Cas9 knockout or siRNA knockdown of endogenous OSTC in canine cells would create platforms to study loss-of-function effects and for complementation experiments with recombinant dog OSTC.

• Heterologous expression systems: Human HEK293 cells (as mentioned in result ) are commonly used for expressing mammalian membrane proteins when species-specific cell lines are unavailable or challenging to culture.

• Microsomes: Endoplasmic reticulum-derived microsomes from canine cells could serve as a subcellular system for studying OSTC within its native membrane environment.

• Yeast complementation models: S. cerevisiae strains with deletions in the yeast OSTC ortholog could potentially be complemented with dog OSTC to assess functional conservation across species.

Researchers should select models based on their specific experimental questions, considering the membrane-bound nature of OSTC and its function in the oligosaccharyltransferase complex.

How do mutations in dog OSTC affect N-glycosylation patterns and substrate specificity?

The effect of dog OSTC mutations on N-glycosylation patterns represents an advanced research question not directly addressed in the search results. Based on knowledge of the OST complex function, researchers investigating this question would likely approach it through several methodologies:

• Site-directed mutagenesis of conserved residues in recombinant dog OSTC, targeting regions predicted to be involved in subunit interactions or substrate recognition.

• Expression of mutant versions in cellular systems with OSTC knockout/knockdown backgrounds to assess rescue capacity.

• Analysis of global N-glycosylation patterns using lectin blots, mass spectrometry-based glycomics, or fluorophore-assisted carbohydrate electrophoresis (FACE) to detect subtle changes in glycan structures.

• Glycoproteomic analysis to identify specific proteins whose glycosylation is altered by OSTC mutations, potentially revealing substrate preferences.

The STT3A-containing OST complex (which includes OSTC) is known to preferentially glycosylate certain substrate classes, particularly those with sequons located close to the translocation site . Mutations in OSTC might alter these preferences by changing the structural arrangement of the complex or modifying interactions with the translocon machinery. Of particular interest would be examining whether OSTC mutations affect the N-glycosylation of APP (amyloid-beta precursor protein), as human OSTC has been implicated in modulating APP processing through its glycosylation .

How does the expression of dog OSTC vary across different tissues and developmental stages?

The search results don't provide information about the tissue-specific or developmental expression patterns of dog OSTC. This represents an important research gap that investigators might address through several approaches:

• Quantitative transcriptomics: RNA-seq or qRT-PCR analysis of dog OSTC mRNA across various tissues and developmental timepoints to establish a comprehensive expression atlas.

• Proteomics: Mass spectrometry-based quantification of OSTC protein levels in different canine tissues.

• Immunohistochemistry: Using validated antibodies against dog OSTC to visualize protein expression patterns in tissue sections, providing spatial information not available through bulk analysis methods.

• Promoter analysis: Characterizing the dog OSTC gene promoter and identifying tissue-specific transcription factor binding sites that might regulate differential expression.

Understanding tissue-specific expression patterns would be particularly valuable given that protein glycosylation requirements vary substantially between tissues. Tissues with high secretory demands (such as pancreas or salivary glands) or those producing heavily glycosylated proteins (like mucin-secreting tissues) might exhibit elevated OSTC expression. Similarly, developmental regulation of OSTC might reveal periods of enhanced N-glycosylation activity corresponding to organogenesis or other developmental processes requiring extensive protein processing.

What is the impact of OSTC dysfunction on dog disease models?

• Congenital disorders of glycosylation (CDG): OSTC dysfunction could potentially manifest as a form of CDG in dogs, characterized by hypoglycosylation of multiple proteins. Researchers could screen for naturally occurring mutations in canine populations or generate models using CRISPR/Cas9.

• Neurodegenerative diseases: Given the human OSTC's reported involvement in APP processing and potential impact on gamma-secretase cleavage , canine models of cognitive dysfunction syndrome (dog equivalent of Alzheimer's) might be examined for OSTC alterations.

• Cancer models: Aberrant glycosylation is a hallmark of cancer, and researchers might investigate whether OSTC expression or function is altered in canine tumor samples, particularly in cancers with known glycosylation abnormalities.

• Autoimmune conditions: Improper glycosylation can expose neo-epitopes that trigger autoimmunity. Canine autoimmune diseases might be examined for connections to OSTC dysfunction.

• ER stress-related conditions: As N-glycosylation is critical for proper protein folding, OSTC dysfunction could contribute to ER stress and unfolded protein response activation in various tissues.

Investigation would require establishing clear genotype-phenotype correlations through techniques like whole genome sequencing of affected dogs, tissue-specific OSTC knockout models, or detailed glycomic analysis of disease tissues.

How does dog OSTC compare structurally and functionally to OSTC proteins in other species?

A comparative analysis of dog OSTC with other species would typically involve sequence alignment, structural predictions, and functional conservation studies. Based on the available information:

The dog OSTC protein consists of 149 amino acids , which appears to be similar in length to human OSTC. While comprehensive multi-species alignment data isn't provided in the search results, the fundamental function of OSTC as a component of the oligosaccharyltransferase complex is likely evolutionarily conserved across mammals given the essential nature of N-glycosylation in eukaryotes.

The search results mention availability of OSTC proteins from multiple species including human, mouse, rat, bovine, chicken, zebrafish, and Xenopus tropicalis , suggesting that this protein is widely conserved across vertebrates. Researchers interested in evolutionary comparisons might analyze:

• Sequence conservation: Identifying highly conserved domains that likely represent functional regions essential for complex assembly or substrate recognition.

• Species-specific variations: Examining regions with lower conservation that might reflect adaptations to species-specific glycosylation requirements.

• Structural predictions: Using comparative modeling to predict structural differences, particularly in transmembrane topology or interaction interfaces.

• Cross-species complementation: Testing whether dog OSTC can functionally replace OSTC in other species' cellular systems, which would provide direct evidence of functional conservation.

The evolutionary conservation of OSTC likely reflects the fundamental importance of N-glycosylation across all eukaryotic organisms.

What can phylogenetic analysis of OSTC reveal about the evolution of protein glycosylation?

OSTC is part of the N-glycosylation machinery, one of the most ancient and conserved post-translational modification systems in eukaryotes. Researchers investigating the evolutionary history of OSTC might:

• Construct comprehensive phylogenetic trees using OSTC sequences from diverse organisms spanning different taxonomic groups (vertebrates, invertebrates, plants, fungi, and protists).

• Compare OSTC evolution with that of other OST complex components, particularly the catalytic STT3 subunits (STT3A and STT3B in higher eukaryotes).

• Analyze rates of evolutionary change in different OSTC domains to identify regions under different selective pressures.

• Map known functional residues onto the phylogenetic analysis to understand how functional innovations in N-glycosylation correlate with OSTC sequence evolution.

• Examine the co-evolution of OSTC with glycosylation-dependent proteins across species.

Such analysis could reveal when the specialized STT3A-containing complex (which includes OSTC) diverged from ancestral OST complexes, potentially correlating with the evolution of complex multicellularity and increased demands for sophisticated protein quality control systems.

How do posttranslational modifications of OSTC differ between dogs and humans?

The search results don't provide specific information about post-translational modifications (PTMs) of dog OSTC, nor do they detail comparative data between dog and human OSTC PTMs. This represents a knowledge gap that researchers might address through several approaches:

• Proteomic analysis: Using mass spectrometry-based approaches to characterize PTMs in natively expressed OSTC purified from dog and human tissues or cell lines.

• Site prediction: Computational prediction of potential modification sites in both species based on known consensus sequences for various modifications.

• Modification-specific antibodies: Using antibodies that recognize specific PTMs to compare their presence in dog versus human OSTC.

• Metabolic labeling: Employing techniques like SILAC (Stable Isotope Labeling by Amino acids in Cell culture) combined with mass spectrometry to identify and quantify species-specific differences in modification rates.

Potential PTMs of interest might include:

• Phosphorylation of cytoplasmic domains that might regulate function

• Ubiquitination or SUMOylation that could affect protein stability or trafficking

• Palmitoylation or other lipid modifications that enhance membrane association

• Glycosylation of luminal domains

Differences in PTMs between species could reflect adaptations to species-specific requirements for N-glycosylation regulation or different cellular environments in which OSTC must function.

What are common challenges in expressing and purifying recombinant dog OSTC?

The expression and purification of recombinant dog OSTC likely presents several challenges common to membrane proteins, though the search results don't detail specific difficulties. Based on the information provided and general knowledge of membrane protein biochemistry, researchers might encounter:

• Inclusion body formation: As a hydrophobic membrane protein expressed in E. coli , dog OSTC may form insoluble inclusion bodies requiring specialized solubilization and refolding protocols.

• Proper folding: Ensuring correct folding of transmembrane domains in the absence of the ER membrane and associated folding machinery presents a significant challenge.

• Protein stability: The recommendation to avoid repeated freeze-thaw cycles suggests stability concerns, which are common with membrane proteins that may aggregate or denature when removed from their native lipid environment.

• Purification efficiency: The hydrophobic nature of OSTC may require careful optimization of detergent conditions during purification to maintain solubility while preserving native-like structure.

• Yield limitations: Expression levels of membrane proteins are often lower than soluble proteins, potentially requiring scale-up strategies.

Researchers might address these challenges through:

• Testing multiple expression systems (bacterial, insect, mammalian)

• Optimizing induction conditions (temperature, inducer concentration, duration)

• Exploring fusion partners that enhance solubility

• Screening different detergents for optimal extraction and purification

• Considering membrane-mimetic systems (nanodiscs, liposomes) for final protein storage

How can researchers distinguish between functional and non-functional recombinant dog OSTC?

Distinguishing functional from non-functional recombinant dog OSTC presents a significant challenge due to its non-catalytic nature and requirement for integration into a multi-protein complex. Researchers might employ several approaches:

• Structural integrity assessment:

  • Circular dichroism spectroscopy to verify secondary structure content

  • Limited proteolysis to determine proper folding (well-folded proteins often show discrete digestion patterns)

  • Size-exclusion chromatography to detect aggregation

• Interaction capability:

  • Pull-down assays with other OST complex components, particularly STT3A

  • Surface plasmon resonance to measure binding kinetics with partner proteins

  • Crosslinking studies to capture transient interactions

• Functional complementation:

  • Rescue experiments in OSTC-deficient cellular systems, measuring restoration of N-glycosylation activity

  • In vitro reconstitution of the OST complex with purified components

• Membrane integration:

  • Flotation assays to verify association with lipid bilayers

  • Protease protection assays to confirm proper topology

Researchers should establish clear acceptance criteria for functionality based on multiple parameters rather than relying on a single metric, given the complex nature of OSTC function within the larger OST machinery.

What controls and validation steps are essential when studying recombinant dog OSTC in research applications?

When studying recombinant dog OSTC, researchers should implement several critical controls and validation steps to ensure reliable and reproducible results:

• Protein quality controls:

  • SDS-PAGE with appropriate molecular weight standards to confirm size and purity (>90% purity is mentioned in the search results)

  • Western blotting with anti-His antibodies to confirm tag presence and integrity

  • Mass spectrometry to verify protein identity and detect potential degradation products

• Functional controls:

  • Positive control: Native OST complex or functionally validated recombinant OSTC

  • Negative control: Heat-denatured OSTC or a mutant version with known loss of function

  • System control: Complete reaction mixture without OSTC to establish baseline activity

• Expression system considerations:

  • For E. coli-expressed OSTC , controls addressing potential contamination with bacterial proteins or endotoxins

  • Comparison with OSTC expressed in eukaryotic systems to assess impact of post-translational modifications

• Storage and handling validation:

  • Stability testing under recommended storage conditions (with 6% trehalose, pH 8.0)

  • Assessment of activity retention after storage with different glycerol concentrations (5-50%)

  • Functionality comparison between fresh and stored protein samples

• Experimental reproducibility:

  • Technical replicates to assess method variability

  • Biological replicates using different batches of recombinant protein

  • Inter-laboratory validation when possible