Recombinant Dog Orexin receptor type 2 (HCRTR2)

Shipped with Ice Packs
In Stock

Description

Molecular Definition & Production

Recombinant Dog HCRTR2 (Uniprot: Q9TUP7) is expressed in E. coli systems with a N-terminal 10xHis tag, spanning amino acids 1-444 . Key characteristics include:

PropertySpecification
Product CodeCSB-CF880008DO
Storage-20°C (short-term); -80°C (long-term)
Expression SystemE. coli (in vitro)
Molecular Weight~50 kDa (glycosylated form)
Ligand BindingOrexin A/B with OX2R selectivity

The protein retains functional domains for orexin peptide interaction and G-protein coupling, mimicking native receptor behavior .

Role in Canine Narcolepsy Research

HCRTR2 mutations are directly linked to narcolepsy in dogs:

  • Exon-skipping mutations cause truncated receptors lacking membrane localization and signaling .

  • E54K substitution in Dachshunds results in autosomal recessive narcolepsy due to impaired ligand binding .

  • Drug response studies show HCRTR2-mutated dogs exhibit unaltered hypocretin levels despite cataplexy modulation by cholinergic/aminergic drugs, indicating disrupted feedback loops .

Disease Modeling

  • Narcolepsy: Used to study hypocretin signaling deficits and test therapeutics like suvorexant .

  • Cardiac Pain: OX2R protein detected in sensory neurons innervating the heart suggests roles in nociception .

  • Reproductive Studies: Localized in Leydig/Sertoli cells, though no direct impact on steroidogenesis observed in cryptorchid dogs .

Pharmacological Assays

  • Binding assays: Measure antagonist efficacy (e.g., OX2R-specific inhibitors) .

  • Calcium mobilization: HEK-293 cell models assess receptor activation via FLIPR/Fura-2 imaging .

Research Limitations & Considerations

  • Species-specificity: Canine OX2R shares 95% identity with human OX2R but differs in OB peptide binding regions .

  • Storage sensitivity: Repeated freeze-thaw cycles degrade activity; single-use aliquots recommended .

  • Expression challenges: Requires lipid-rich environments for proper folding due to transmembrane domains .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand you may have specific requirements. Please indicate your preferred format when placing your order, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend reaching out to your local distributor for precise delivery estimates.
Note: All our proteins are standardly shipped with normal blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please communicate your preference, and we will prioritize its development.
Synonyms
HCRTR2; Orexin receptor type 2; Ox-2-R; Ox2-R; Ox2R; Hypocretin receptor type 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MSGTKLEDSPPCRNWSSAPELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG YIIVFVVALVGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS CIIMIPQAIVMECSTMLPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPASQPRGPGQQTKSRISAVAAEIKQIRARR KTARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTFSHWLVYANSAAN PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNVSKL SEQVVLTSISTLPAANGAGPLQNW
Uniprot No.

Target Background

Function
This protein acts as a nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Its binding with orexin-A triggers an increase in cytoplasmic Ca(2+) levels.
Gene References Into Functions
  1. A mutation in the Hcrtr2 gene alters the normal developmental course of hypocretin-1 levels. PMID: 15308685
  2. We measured hcrtR1 and hcrtR2 expression in the frontal cortex and pons using the RT-PCR method in murine models, in canine models, and in humans. PMID: 18714784
Database Links
Involvement In Disease
Defects in HCRTR2 are a cause of an autosomal recessive form of narcolepsy, observed in labradors, dobermans and dachshunds. Narcolepsy is a neurological sleep disorder affecting animals and humans, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, such as cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. As in humans, most cases of canine narcolepsy are sporadic but an autosomal recessive form was also observed.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions About Recombinant Dog HCRTR2

The fundamental properties of recombinant dog orexin receptor type 2 provide the foundation for more advanced research applications. Understanding these basic characteristics is essential for researchers designing experiments involving this receptor. This section addresses core questions about structure, expression, and binding properties that frequently arise in early-stage research planning.

What is the molecular structure of dog HCRTR2 and how does it compare to human HCRTR2?

Dog HCRTR2, like its human counterpart, is a G-protein coupled receptor with seven transmembrane domains. Human HCRTR2 mRNA is 1843 bp in length and encodes a protein of 444 amino acids . While specific dog HCRTR2 sequence data is limited in the provided resources, the high conservation of orexin receptors across mammalian species suggests significant homology. Human and rat OX2R share 95% identity, indicating that the orexin receptor is highly conserved among mammals . This conservation suggests that dog HCRTR2 likely maintains similar structural features, though with species-specific variations in certain domains that may affect ligand binding or signaling efficiency.

The receptor's tertiary structure includes extracellular loops that form the binding pocket for orexin neuropeptides and intracellular regions that interact with various G-proteins and other signaling molecules. For effective experimental design, researchers should consider that both structural and functional analyses indicate HCRTR2 is a non-selective receptor that binds both orexin-A and orexin-B with similar affinities, unlike the HCRTR1 which preferentially binds orexin-A .

What expression systems are most effective for producing functional recombinant dog HCRTR2?

For successful expression of functional recombinant dog HCRTR2, mammalian cell expression systems generally yield better results than bacterial or insect cell systems due to the requirement for proper post-translational modifications and membrane integration. Several approaches have proven effective:

  • HEK293 Cell System: Human embryonic kidney cells provide efficient expression of properly folded and functionally active GPCRs, including orexin receptors. This system has been successfully used for human HCRTR2 studies and is likely applicable to dog HCRTR2 .

  • CHO Cell System: Chinese hamster ovary cells stably expressing orexin receptors have been extensively used to study signal transduction pathways. For dog HCRTR2, CHO cells can be transfected with expression vectors containing the canine receptor sequence under a strong promoter .

  • Neuro-2a Cells: These neuroblastoma cells provide a neuronal background that may better replicate the native environment of HCRTR2, potentially preserving signaling mechanisms relevant to neuronal function .

Each expression system has specific advantages depending on the research question. For electrophysiological studies, neuronal cell lines may be preferred, while high-throughput screening might benefit from stable CHO or HEK293 cell lines with robust and consistent expression levels.

How can researchers validate the functional integrity of recombinant dog HCRTR2?

Validation of functional recombinant dog HCRTR2 requires multiple complementary approaches:

  • Calcium Mobilization Assays: Since HCRTR2 activation triggers increased cytoplasmic Ca²⁺ levels, calcium flux assays using fluorescent indicators (e.g., Fluo-4 AM) provide a direct measurement of receptor functionality. A positive response to both orexin-A and orexin-B with similar potency would confirm functional HCRTR2 expression .

  • Electrophysiological Testing: Patch-clamp recordings can verify that the expressed receptors elicit appropriate electrophysiological responses. Functional HCRTR2 should induce membrane depolarization and increased firing rates in response to orexin application, as observed in studies of tuberomammillary nucleus neurons .

  • Western Blot Analysis: Immunoblotting with specific anti-HCRTR2 antibodies can confirm protein expression. The predicted band size for HCRTR2 is approximately 50 kDa, though glycosylation may alter apparent molecular weight .

  • cAMP and MAPK Assays: Since orexin receptors couple to multiple G-proteins, measuring downstream effects on cAMP levels and MAPK pathway activation provides additional confirmation of functional coupling .

A multi-parameter validation approach ensures that the recombinant receptor not only expresses but also maintains proper membrane localization and signaling capabilities.

Advanced Experimental Design and Methodology

Beyond basic characterization, advanced research on recombinant dog HCRTR2 requires sophisticated experimental approaches to elucidate complex signaling mechanisms, protein-protein interactions, and pharmacological properties. This section addresses methodological questions relevant to cutting-edge HCRTR2 research.

What are the optimal conditions for evaluating calcium signaling in cell lines expressing recombinant dog HCRTR2?

Calcium signaling is a primary readout for HCRTR2 activation, requiring careful experimental design for reliable results. The following protocol outlines optimal conditions:

  • Cell Preparation: Culture recombinant dog HCRTR2-expressing cells at 70-80% confluence in serum-free medium for 12-18 hours before assay to minimize background signaling.

  • Dye Loading: Load cells with 2-5 μM Fluo-4 AM or Fura-2 AM for 30-45 minutes at 37°C in a physiological buffer containing probenecid to prevent dye efflux.

  • Buffer Composition: Use HEPES-buffered physiological solution (pH 7.4) containing 1.8-2 mM CaCl₂, as HCRTR2 activation significantly increases intracellular Ca²⁺ levels .

  • Ligand Preparation: Prepare fresh dilutions of orexin-A and orexin-B in buffer containing 0.1% BSA to prevent peptide adherence to plasticware.

  • Signal Acquisition: For kinetic studies, record at 1-2 second intervals for at least 3 minutes after ligand addition. Include positive controls (e.g., ionomycin) and negative controls (buffer only).

  • Data Analysis: Normalize responses to baseline and positive control to account for variation in dye loading and expression levels between experiments.

For high-throughput screening applications, plate-reader based calcium flux assays using FLIPR technology can be adapted, though care must be taken to optimize cell density and measurement parameters for the specific recombinant dog HCRTR2 construct.

How can researchers effectively study G-protein coupling specificity of recombinant dog HCRTR2?

Orexin receptors, including HCRTR2, couple to multiple G-protein subtypes (Gq/11, Gi/o, and Gs) to activate diverse signaling pathways . To characterize coupling specificity:

  • BRET/FRET Assays: Bioluminescence/fluorescence resonance energy transfer approaches directly measure receptor-G protein interactions. For example, tagging dog HCRTR2 with Renilla luciferase and G-protein subunits with YFP enables real-time monitoring of coupling in living cells.

  • Pathway-Selective Inhibitors: Use G-protein-specific inhibitors (e.g., PTX for Gi/o, YM-254890 for Gq/11) to dissect pathway contributions. Compare calcium responses, ERK phosphorylation, or cAMP modulation in the presence and absence of these inhibitors.

  • GTPγS Binding Assays: Measure the exchange of GDP for GTPγS on specific G-protein subunits following HCRTR2 activation to quantify coupling efficiency to different G-protein subtypes.

  • G-protein Knockdown/Knockout: siRNA knockdown or CRISPR/Cas9 knockout of specific G-protein subunits can reveal their contribution to HCRTR2 signaling.

  • Biased Signaling Analysis: Calculate bias factors using operational models to determine if dog HCRTR2 exhibits preferential coupling to specific G-proteins compared to human HCRTR2, which could reveal species-specific signaling patterns.

These approaches provide complementary information about the complex signaling network downstream of dog HCRTR2 and help identify potential species differences in coupling preferences.

What methodologies are available for studying the heterodimerization of dog HCRTR2 with other receptors?

Receptor heterodimerization significantly impacts signaling properties and pharmacology. Several techniques can assess dog HCRTR2 heterodimerization:

  • Proximity Ligation Assay (PLA): This technique detects protein-protein interactions in situ with high specificity. For dog HCRTR2, PLA can visualize potential heterodimers with other GPCRs in native tissues or recombinant systems, similar to the Duolink II in situ approach mentioned for OX1R interactions .

  • FRET/BRET: Tagging dog HCRTR2 and potential partner receptors with appropriate fluorophore/luminophore pairs allows real-time monitoring of dimerization in living cells. Research has shown that OX1R forms heterodimers with the kappa opioid receptor (KOR), leading to altered G-protein coupling preferences .

  • Co-immunoprecipitation: Pull-down experiments using antibodies against dog HCRTR2 followed by western blotting for potential partners can biochemically verify interactions, though this approach is less suitable for membrane proteins.

  • Functional Complementation: Split reporter assays (e.g., split luciferase) where fragments are fused to potential dimerization partners can provide functional evidence of interaction.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify interaction interfaces between dog HCRTR2 and partner receptors.

When designing heterodimerization studies, researchers should consider that dimerization of mOX2αR and mOX2βR has been shown to cause a greater increase in p-ERK 1/2 and intracellular Ca²⁺ elevation after stimulation with orexin peptides , suggesting that heterodimerization significantly modulates signaling outcomes.

Troubleshooting and Data Analysis

Researchers working with recombinant dog HCRTR2 often encounter technical challenges and data interpretation difficulties. This section addresses common issues and provides methodological solutions to ensure robust and reproducible research outcomes.

What are common pitfalls in Western blot analysis of recombinant dog HCRTR2?

Western blot analysis of recombinant dog HCRTR2 presents several challenges that require specific technical approaches:

  • Membrane Protein Extraction: HCRTR2 is a transmembrane protein that requires specialized extraction protocols. Standard RIPA buffers may not efficiently solubilize the receptor. Use detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS at 0.5-1% concentration to maintain protein structure while ensuring extraction.

  • Sample Preparation: Avoid heating samples above 70°C, as this can cause aggregation of membrane proteins. Instead, incubate at 37°C for 30 minutes in Laemmli buffer prior to loading.

  • Antibody Specificity: Validate antibodies using positive controls (e.g., transfected cells overexpressing dog HCRTR2) and negative controls (untransfected cells). The predicted band size for HCRTR2 is approximately 50 kDa, though post-translational modifications may alter migration patterns .

  • Post-translational Modifications: HCRTR2 undergoes glycosylation, which can create heterogeneous banding patterns. Treatment with peptide-N-glycosidase F (PNGase F) can remove N-linked glycans for clearer interpretation.

  • Expression Level Detection: For tissues with low endogenous expression, immunoprecipitation before Western blotting may be necessary. In mouse studies, HCRTR2 has been detected in brain, heart, and kidney tissues .

When troubleshooting unclear or inconsistent results, sequential optimization of extraction methods, blocking conditions, and antibody concentrations will typically resolve most issues with HCRTR2 detection.

How should researchers address inconsistent calcium signaling responses in HCRTR2 functional assays?

Variability in calcium signaling assays with recombinant dog HCRTR2 can arise from multiple sources. A systematic troubleshooting approach includes:

  • Receptor Expression Levels: Confirm consistent receptor expression between experiments using Western blotting or flow cytometry. Consider using fluorescently-tagged constructs to sort for populations with equivalent expression levels.

  • Cell Culture Conditions: Standardize passage number, confluence level, and serum starvation duration. Cells at very high passage numbers may show altered receptor coupling efficiency.

  • Ligand Preparation and Storage: Orexin peptides can adhere to plasticware or degrade during storage. Prepare fresh dilutions in buffer containing 0.1% BSA and avoid freeze-thaw cycles.

  • Signal Desensitization: HCRTR2 undergoes rapid desensitization after activation. Ensure sufficient time between stimulations and consider using protocols that measure acute responses.

  • Calcium Source Analysis: HCRTR2 activation mobilizes calcium from both intracellular stores and extracellular sources. Performing assays in calcium-free buffer with EGTA can help distinguish these components.

  • Technical Variability: Standardize dye loading time, buffer temperatures, and instrument settings. Consider using ratiometric dyes like Fura-2 instead of single-wavelength indicators to control for loading differences.

For quantitative comparisons between experiments, normalize responses to a maximal stimulus (e.g., ionomycin) and report EC50 values rather than absolute signal magnitudes to minimize the impact of technical variability.

How can researchers reconcile contradictory data between in vitro and in vivo HCRTR2 studies?

Discrepancies between in vitro recombinant systems and in vivo observations are common challenges in HCRTR2 research. To address these contradictions:

  • Expression Context Differences: Recombinant systems often overexpress receptors compared to physiological levels. Quantify receptor density in both systems using radioligand binding to assess whether differences might be concentration-dependent.

  • Signaling Network Complexity: In vitro systems lack the complete signaling networks present in vivo. Expand in vitro studies to include relevant signaling partners identified in vivo through proteomics or transcriptomics.

  • Receptor Modifications: Compare post-translational modifications between recombinant and native receptors using mass spectrometry, as these can significantly affect signaling outcomes.

  • Heterodimer Formation: In native tissues, HCRTR2 may form heterodimers that alter signaling properties. Co-express potential partners identified in vivo in your recombinant system to test if this reproduces the observed in vivo responses.

  • Temporal Dynamics: In vivo systems have complex temporal regulation. Design in vitro experiments that mimic physiological stimulation patterns rather than simple acute challenges.

The rescue experiments conducted with OX2R TD mice demonstrate how targeted restoration of receptor expression in specific brain regions can disambiguate receptor functions . Similar approaches combining in vitro mechanistic studies with targeted in vivo manipulations provide the most complete understanding of HCRTR2 biology.

Comparative Aspects and Translational Research

Understanding species differences in HCRTR2 structure and function is crucial for translational research. This section explores how dog HCRTR2 studies can inform comparative neurobiology and contribute to both human and veterinary medicine.

How does canine HCRTR2 function compare to human HCRTR2 in narcolepsy models?

Comparative research on dog and human HCRTR2 provides valuable insights into narcolepsy mechanisms:

  • Genetic Aspects: Naturally occurring narcolepsy in Doberman pinschers and Labrador retrievers has been linked to HCRTR2 mutations, making canine narcolepsy an important comparative model. These spontaneous mutations provide a unique opportunity to study receptor dysfunction in a naturally occurring context, complementing engineered mouse models.

  • Signaling Pathways: While human and canine HCRTR2 likely share core signaling mechanisms, subtle species differences may exist. Both receptors are nonselective for orexin-A and orexin-B and trigger increases in cytoplasmic calcium levels upon activation , but downstream coupling efficiencies may vary.

  • Neuroanatomical Distribution: The distribution of HCRTR2 in the tuberomammillary nucleus appears critical for wake maintenance across species. In mouse models, restoration of OX2R expression in the tuberomammillary nucleus rescued the sleepiness phenotype but not sleep fragmentation , suggesting conserved functional neuroanatomy that likely extends to dogs and humans.

  • Pharmacological Responses: Comparative pharmacology studies can reveal species-specific differences in drug responses. Human and dog HCRTR2 may show different affinities or efficacy profiles for synthetic agonists or antagonists, which has implications for drug development.

The high conservation of orexin receptors across mammals (human and rat OX2R share 95% identity) suggests functional conservation, but targeted comparative studies are needed to identify clinically relevant species differences.

What methodologies are most effective for translating findings from recombinant dog HCRTR2 to clinical applications?

Translating basic HCRTR2 research to clinical applications requires integrative approaches:

  • Comparative Binding Studies: Assess whether compounds identified using recombinant dog HCRTR2 have similar binding profiles on human HCRTR2 through competitive binding assays with radiolabeled orexins.

  • Functional Cross-Species Comparison: Compare calcium responses, G-protein activation, and downstream signaling cascades between dog and human HCRTR2 under identical experimental conditions to identify conserved and divergent properties.

  • Ex Vivo Tissue Validation: Test compounds identified in recombinant systems on brain slices from both species, focusing on regions with high HCRTR2 expression such as the tuberomammillary nucleus.

  • Physiological Readouts: Validate findings using sleep-wake recordings in dog models before moving to human trials, as demonstrated in studies showing that OX2R in the tuberomammillary region plays an essential role in wake promotion .

  • Receptor Chimeras and Point Mutations: Create chimeric receptors incorporating domains from dog and human HCRTR2 to isolate regions responsible for species-specific responses to compounds of interest.

These translational approaches can accelerate the development of orexin-targeted therapeutics for sleep disorders while accounting for species differences that might affect drug efficacy or safety.

How can recombinant dog HCRTR2 studies inform the development of veterinary treatments for canine sleep disorders?

Canine sleep disorders, though less studied than human conditions, represent an important veterinary challenge that can benefit from HCRTR2 research:

  • Breed-Specific Pharmacology: Different dog breeds may have polymorphisms in HCRTR2 that affect drug responses. Recombinant expression of breed-specific variants allows for personalized medicine approaches in veterinary practice.

  • Age-Related Changes: Studies comparing HCRTR2 expression and function across different canine life stages can inform age-appropriate dosing for orexin-targeting compounds.

  • Comorbidity Considerations: Many canine patients with sleep disorders have comorbidities requiring multiple medications. Drug-drug interaction studies using recombinant dog HCRTR2 can identify potential contraindications specific to veterinary applications.

  • Biomarker Development: Identification of downstream signaling products specific to dog HCRTR2 activation could yield biomarkers for monitoring treatment efficacy in veterinary settings.

  • Specialized Formulations: Pharmacokinetic differences between humans and dogs may necessitate specialized drug formulations. Recombinant dog HCRTR2 studies can inform the development of orexin modulators with optimal properties for canine physiology.

By addressing these veterinary-specific aspects, recombinant dog HCRTR2 research can contribute to improved quality of life for canine patients while simultaneously advancing comparative understanding of the orexin system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.