Recombinant Dog Palmitoyltransferase ZDHHC5 (ZDHHC5)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant Dog ZDHHC5 is produced in mammalian expression systems to ensure proper post-translational modifications. Key specifications include:

ParameterDescription
Product CodeCSB-CF647211DO
Storage-20°C (short-term); -80°C for long-term preservation
Purity>90% by SDS-PAGE (inferred from recombinant protein standards)
Species ReactivityCanis lupus familiaris (Dog)

Research Applications

Recombinant Dog ZDHHC5 enables species-specific investigations into:

  • Comparative Palmitoylation Mechanisms: Differences in substrate specificity between canine and human PATs.

  • Veterinary Therapeutics: Targeting ZDHHC5 in canine cancers or metabolic disorders.

  • Toxin Processing: Studying anthrax toxin activation in dogs, as ZDHHC5 palmitoylates proteases like Furin/PC7 in humans .

Pharmacological Targeting

Small-molecule inhibitors like Lomitapide block ZDHHC5 activity by binding near its catalytic site (Cys134), inhibiting palmitoylation of oncogenic substrates . This highlights potential translational applications for the canine enzyme in drug development.

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve full-length canine ZDHHC5.

  • In Vivo Models: Generating Zdhhc5-knockout dogs to study tissue-specific palmitoylation deficits.

  • Therapeutic Screening: Testing ZDHHC5 inhibitors in canine cancer cell lines .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate this beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it.
Synonyms
ZDHHC5; Palmitoyltransferase ZDHHC5; Zinc finger DHHC domain-containing protein 5; DHHC-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-715
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLCVSPAVPIYNAIVFLFVLA NFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHC SVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHMEELSG VRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNV SRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRSKSKGSL EVTESQSADAEPPPPPKPDLSRYTGLRTHLTLAANEDSSLLGKDSPPTPTMYKYRPGYSS SSTSAAMPHSSSAKLSRGDSLKEPTSIAESSRHPSYRSEPSLEPESFRSPTFGKSFHFDP LSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSP DFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHI VASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLVKTPL GRPAAPRFGKPDGLRGRGLGSPEPGPTAPYLGRSMSYSSQKAPAGVSEAEEVALQPLLTP KDEVQLKTAYSKSNGQPKSIGSASPGPGQQPLSSPTRGGVKKVSGVGGTTYEISV
Uniprot No.

Target Background

Function
Palmitoyltransferase is an enzyme responsible for catalyzing the addition of palmitate to various protein substrates. This enzyme plays a crucial role in numerous cellular processes. It palmitoylates the G-protein coupled receptor SSTR5 and FLOT2, among other substrates.
Database Links

KEGG: cfa:483490

UniGene: Cfa.30636

Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC5 and what is its primary function?

ZDHHC5 belongs to the ZDHHC S-palmitoyltransferase family, which catalyzes the addition of medium-chain fatty acids, primarily palmitate (C16), to cytoplasmic cysteines of target proteins through a process called S-palmitoylation . Unlike most ZDHHC enzymes that localize to the early biosynthetic pathway (endoplasmic reticulum and Golgi), ZDHHC5 predominantly localizes to the endosomal system, allowing it to modify a unique set of substrates and potentially affect their trafficking, turnover rate, and function . This localization is critical for its role in regulating protein trafficking in the endocytic pathway.

What are the confirmed substrates of ZDHHC5?

ZDHHC5 has been shown to palmitoylate multiple substrates across different tissues, with particular importance in cardiac and neuronal cells. The confirmed substrates include:

SubstrateFull NameFunction/SystemReference
STREX BKStress-regulated exon of voltage-activated potassium channelIon channel regulation
PSD-95/DLG4Postsynaptic density protein 95Neuronal function
SSTR5Somatostatin receptor 5Signaling
FLOT1/2Flotillin-1/2Membrane organization
GRIP1Glutamate receptor interacting protein 1Neuronal function
NCX1Sodium/calcium exchanger 1Cardiac function
PLMPhospholemmanSodium pump regulation
δ-cateninDelta-cateninCell adhesion
EZH2Enhancer of zeste homolog 2Epigenetic regulation
S1PR1Sphingosine-1-phosphate receptor 1Signaling
Furin/PC7Proprotein convertasesProtein processing

How is ZDHHC5 structurally organized?

ZDHHC5 contains the canonical four transmembrane domains that harbor the active site, followed by a long, largely unfolded cytoplasmic C-terminal domain approximately 500 amino acids in length . This C-terminal tail is proposed to mediate substrate interactions and contains important regulatory elements:

  • A PLM binding site positioned just after the final transmembrane domain

  • A di-cysteine motif situated at residues 236/237 that serves as a palmitoylation site

  • Two LC3-interacting region domains, consistent with a role in autophagy

This structural organization allows ZDHHC5 to interact with diverse substrates and respond to various cellular signals.

How is ZDHHC5 itself regulated by post-translational modifications?

ZDHHC5 undergoes autopalmitoylation at its catalytic cysteine within the DHHC motif as part of its catalytic cycle, but it is also regulated by palmitoylation at other sites. Specifically:

  • ZDHHC5 is palmitoylated on its C-tail at a di-cysteine motif (residues 236/237) situated close to the PLM binding site .

  • Overexpression of ZDHHC20 increases palmitoylation of ZDHHC5 in HEK293 cells, but not when the di-cysteine motif is mutated .

  • ZDHHC20-mediated palmitoylation of ZDHHC5 increases co-immunoprecipitation of PLM with ZDHHC5, demonstrating functional consequences of this modification .

  • Palmitoylation of ZDHHC5 is altered in heart failure models, similar to changes observed in its substrate NCX1, suggesting coordinate regulation .

These modifications appear critical for ZDHHC5's ability to recruit and palmitoylate certain substrates, particularly in the cardiac system.

What is the significance of the ZDHHC5 C-terminal tail in substrate selection?

The C-terminal cytoplasmic domain of ZDHHC5 (approximately 500 amino acids) plays a crucial role in substrate recognition and binding:

  • The PLM binding site identified using a peptide-based array is positioned just after the final transmembrane domain .

  • The di-cysteine palmitoylation motif at residues 236/237 is situated close to this PLM binding site and affects substrate recruitment .

  • The C-terminal tail mediates interactions with various substrates including PSD-95 and several cardiac proteins .

  • ZDHHC5-substrate interactions have been found to depend on phosphorylation of the substrate in some cases . For example, Furin has been shown to be phosphorylated and PC7 has one proposed phosphorylation site in its cytoplasmic tail, suggesting a potential regulatory mechanism for ZDHHC5-mediated modification of these proprotein convertases .

This extended C-terminal domain is relatively unique among ZDHHC family members and likely contributes to ZDHHC5's diverse substrate range and regulatory capabilities.

How does ZDHHC5 affect cellular protein trafficking and surface expression?

ZDHHC5 has significant effects on protein trafficking and surface expression through both direct and indirect mechanisms:

This combination of direct substrate modification and broader effects on endocytic trafficking makes ZDHHC5 a key regulator of protein surface expression and localization.

What are effective methods for studying ZDHHC5 function in vitro?

Several complementary approaches can be used to study ZDHHC5 function:

  • Gene silencing approaches:

    • ZDHHC5-siRNA transfection has been effectively used to knockdown ZDHHC5 expression in cell lines such as Panc-1 and Mia PaCa-2 .

    • Stable ZDHHC5-knockdown cell lines can be constructed and confirmed via RT-qPCR and Western blot analysis .

  • Protein interaction studies:

    • Co-immunoprecipitation assays can detect interactions between ZDHHC5 and potential substrates .

    • Small peptide-based arrays can identify binding sites for substrates on the ZDHHC5 C-tail .

  • Palmitoylation detection:

    • Acyl-biotin exchange (ABE) or metabolic labeling with palmitate analogues can be used to assess palmitoylation levels of ZDHHC5 substrates .

    • Site-directed mutagenesis of cysteine residues can help identify specific palmitoylation sites .

  • Functional assays:

    • PC biosensors designed to localize to specific cellular sites can report on local action of proprotein convertases in different cellular compartments .

    • Analytical flow cytometry can provide quantitative assessment of substrate processing in response to ZDHHC5 manipulation .

How can researchers identify novel ZDHHC5 substrates?

Identifying novel ZDHHC5 substrates requires a combination of approaches:

  • Proteomic screening:

    • Compare palmitoylation profiles in control versus ZDHHC5-deficient cells using techniques like acyl-RAC or acyl-biotin exchange coupled with mass spectrometry.

    • Analyze the surface proteome of control and ΔZDHHC5 cells through surface biotinylation, isolation, and mass spectrometry .

  • Bioinformatic prediction:

    • Use palmitoylation prediction algorithms alongside the SwissPalm 2.0 palmitoylation database (https://swisspalm.org/) to identify candidates .

    • Focus on proteins that contain cysteines in similar structural contexts to known ZDHHC5 substrates.

  • Validation experiments:

    • Direct in vitro palmitoylation assays using purified ZDHHC5 and candidate substrates.

    • Co-immunoprecipitation studies to detect physical interaction between ZDHHC5 and candidate substrates.

    • Examine palmitoylation of candidates upon ZDHHC5 overexpression or knockdown.

    • Test substrate recruitment using peptide-based arrays similar to those used for identifying the PLM binding site .

What controls should be included when measuring ZDHHC5 activity?

When studying ZDHHC5 activity, the following controls are essential:

  • Enzyme controls:

    • Catalytically inactive ZDHHC5 mutant (typically mutation of the cysteine in the DHHC motif)

    • Other ZDHHC enzyme overexpression to test substrate specificity

  • Substrate controls:

    • Cysteine-to-alanine mutations of potential palmitoylation sites

    • Known ZDHHC5 substrates as positive controls (e.g., PLM or NCX1 in cardiac cells)

  • Palmitoylation inhibitor controls:

    • Global palmitoylation inhibitors (e.g., 2-bromopalmitate)

    • Palmitate analogues for metabolic labeling studies

  • System-specific controls:

    • When studying ZDHHC5 in disease models, proper matching of controls is critical, as expression and activity can vary between models .

    • For cardiac studies, consider both expression and palmitoylation status of ZDHHC5 itself, as this can be altered in disease states .

How is ZDHHC5 expression altered in cardiac disease?

ZDHHC5 expression exhibits dynamic changes across different cardiac disease states:

  • Cardiac hypertrophy:

    • ZDHHC5 expression is significantly increased in early cardiac hypertrophy models .

    • This suggests potential involvement in the early pathogenesis of cardiac hypertrophy.

  • Heart failure:

    • In contrast to hypertrophy, ZDHHC5 expression is either unchanged (rabbit model), modestly reduced (pig model), or significantly reduced (human samples) in heart failure settings .

    • Interestingly, these expression changes don't consistently correlate with changes in substrate palmitoylation. For example, palmitoylation of NCX1 was significantly reduced in animal models of heart failure but significantly increased in human heart failure samples .

  • Regulation in disease:

    • ZDHHC5 itself is subject to palmitoylation changes in heart failure, with its palmitoylation significantly reduced in the pig model but modestly increased in human heart failure samples .

    • These findings suggest complex regulatory mechanisms beyond simple expression changes, possibly involving acyl-CoA availability or other regulatory factors .

These observations indicate that ZDHHC5 dysregulation may be involved in cardiac pathophysiology, though the precise mechanisms remain to be fully elucidated.

What is the role of ZDHHC5 in bacterial toxin action?

ZDHHC5 plays a critical role in bacterial toxin action, particularly for anthrax toxin:

  • Anthrax toxin entry:

    • ZDHHC5 activity is required for anthrax lethal toxin action .

    • Knockdown or knockout of ZDHHC5 leads to strong inhibition of toxin action in multiple cell types .

  • Mechanism of action:

    • ZDHHC5 palmitoylates proprotein convertases Furin and PC7, which are required for processing anthrax protoxin to its active form .

    • This palmitoylation promotes association of Furin and PC7 with plasma membrane microdomains, facilitating their encounter with receptor-bound toxin .

    • Without this palmitoylation-driven microdomain association, the encounter between the low-abundance toxin and convertases is kinetically unfavorable .

  • Broader implications:

    • ZDHHC5 is also required for the action of other toxins that use proprotein convertases, such as the pore-forming toxin aerolysin .

    • This suggests ZDHHC5 might be a potential target for broad-spectrum anti-toxin therapies.

What is the emerging role of ZDHHC5 in cancer?

Evidence is accumulating for ZDHHC5 involvement in cancer:

  • Expression patterns:

    • The expression level of ZDHHC5 is higher in several cancer cell lines compared to non-cancerous HPDE cells .

  • Functional effects:

    • ZDHHC5 knockdown using siRNA significantly decreases cell proliferation in Panc-1 and Mia PaCa-2 cell lines .

    • Stable ZDHHC5-knockdown cell lines also show decreased proliferation ability .

  • Potential mechanisms:

    • The mechanism may involve ZDHHC5's role in regulating the endocytic pathway and protein trafficking .

    • Specific cancer-relevant substrates of ZDHHC5 still need to be fully identified.

  • Therapeutic potential:

    • The anti-proliferative effect of ZDHHC5 silencing suggests it could be a potential therapeutic target in cancer .

    • Repositioning of existing drugs to target ZDHHC5-dependent palmitoylation is being explored as a potential approach .

How can researchers reconcile contradictory findings regarding ZDHHC5 expression and substrate palmitoylation?

Several studies have reported apparently contradictory findings regarding ZDHHC5 expression and its effects on substrate palmitoylation, particularly in disease models:

  • Expression-function discrepancies:

    • In heart failure models, ZDHHC5 expression changes did not consistently match changes in palmitoylation of its substrate NCX1 .

    • NCX1 palmitoylation was reduced in animal models but increased in human samples, despite similar ZDHHC5 expression patterns .

  • Methodological approaches to reconciliation:

    • Comprehensive substrate profiling: Examine multiple substrates simultaneously rather than focusing on a single substrate.

    • Consider palmitoylation of ZDHHC5 itself: ZDHHC5 palmitoylation status may affect its activity independently of expression levels .

    • Analyze cofactor availability: Levels of acyl-CoA and other cofactors may vary between models.

    • Examine the entire palmitoylation machinery: Other ZDHHC enzymes or depalmitoylating enzymes may compensate for ZDHHC5 changes.

  • Experimental design considerations:

    • Comparing overexpression vs. knockdown: Overexpression of zDHHC5 in rabbit ventricular cardiomyocytes was not sufficient to drive changes in palmitoylation of zDHHC5 substrates, suggesting that changes in zDHHC5 expression in disease may not be a primary driver of pathology .

    • Time course analysis: Sample collection timing relative to disease progression is critical, as ZDHHC5 expression changes from hypertrophy to heart failure .

What are key considerations when designing experiments to study ZDHHC5 in different species?

When studying ZDHHC5 across different species, researchers should consider:

  • Sequence conservation:

    • Verify the degree of conservation of ZDHHC5 between the species of interest, particularly in key functional domains.

    • The C-terminal tail, which is critical for substrate interactions, may exhibit species-specific variations.

  • Expression patterns:

    • ZDHHC5 expression levels and tissue distribution may vary between species.

    • In cardiac studies, species differences have been observed between rabbit, pig, and human samples .

  • Substrate conservation:

    • Ensure that putative substrates are conserved between species.

    • Verify conservation of palmitoylation sites within substrates.

  • Disease model differences:

    • Different animal models may show distinct ZDHHC5 expression patterns in response to similar disease conditions .

    • For example, zDHHC5 palmitoylation was significantly reduced in the pig heart failure model but modestly increased in human heart failure samples .

  • Experimental validation:

    • Cross-validate findings in multiple species where possible.

    • Consider using species-specific recombinant proteins when studying direct enzyme-substrate interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.