Recombinant Dog Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R)

Shipped with Ice Packs
In Stock

Description

Introduction to Parathyroid Hormone/Parathyroid Hormone-Related Peptide Receptor

The Parathyroid Hormone/Parathyroid Hormone-Related Peptide Receptor, commonly known as PTH1R, is a G protein-coupled receptor that serves as the primary receptor for both parathyroid hormone (PTH) and parathyroid hormone-related peptide (PTHrP). In mammals, including dogs, this receptor plays a crucial role in calcium and phosphate homeostasis, bone development, and remodeling processes. PTH1R is also referred to by several alternative names in scientific literature, including PTHR, PTHR1, PTH/PTHrP type I receptor, and Parathyroid hormone 1 receptor . The receptor's significance extends beyond normal physiological processes, as it has been implicated in various pathological conditions related to bone metabolism and calcium regulation in canines and other species.

Evolutionary Conservation of PTH1R

PTH1R demonstrates significant evolutionary conservation across mammalian species, suggesting its fundamental biological importance. While the search results do not provide specific information about dog PTH1R, the presence of this receptor has been documented in various species including humans, mice, rats, bovines, and even marsupials (Didelphis marsupialis virginiana) . This high degree of conservation implies that the canine version likely shares substantial structural and functional similarities with these other mammalian counterparts, particularly with other domesticated species such as bovines, making comparative studies highly relevant for understanding the canine receptor.

Predicted Molecular Structure

Based on homology with other mammalian species, canine PTH1R likely consists of an extracellular N-terminal domain, seven transmembrane domains, and an intracellular C-terminal domain. The bovine PTH1R, which may share significant similarity with the canine version, consists of 561 amino acids (positions 29-589) when expressed as a recombinant protein . The receptor likely contains specific binding domains for PTH and PTHrP ligands in its extracellular regions, while the intracellular domains would be involved in G-protein coupling and signal transduction.

Production and Expression Systems for Recombinant Dog PTH1R

The production of recombinant proteins requires appropriate expression systems and purification methods. While the search results don't specifically address canine PTH1R production, they provide insights into common approaches for PTH1R from other species.

Expression Host Systems

Based on the search results, recombinant PTH1R proteins from various species are commonly expressed in several host systems:

Expression HostAdvantagesCommon Applications
E. coliHigh yield, cost-effective, rapid productionBasic research, antibody production
YeastPost-translational modifications, higher eukaryotic systemFunctional studies
BaculovirusComplex protein expression, insect cell-basedStructural studies
Mammalian CellFull post-translational modifications, proper foldingFunctional assays, therapeutic applications

For recombinant mouse and rat PTH1R, multiple expression systems including E. coli, yeast, baculovirus, and mammalian cells have been employed . Similar approaches would likely be suitable for the production of recombinant dog PTH1R, with the selection of the expression system depending on the specific research requirements and intended applications.

Purification and Quality Control

Recombinant PTH1R proteins typically undergo rigorous purification processes to ensure high quality and purity. For bovine PTH1R, purification yielded products with greater than 90% purity as determined by SDS-PAGE . Similarly, recombinant mouse PTH1R achieved purities greater than or equal to 85% as determined by SDS-PAGE . For dog PTH1R, similar purification approaches would likely be employed, including affinity chromatography (particularly for His-tagged versions) followed by additional purification steps as needed.

Common Modifications and Tags

Recombinant PTH1R proteins are often modified with tags to facilitate purification and detection. The bovine PTH1R described in the search results features an N-terminal His tag , which allows for simplified purification using metal affinity chromatography. Similar tagging strategies would likely be employed for recombinant dog PTH1R, potentially including His tags, GST tags, or other common fusion partners depending on the specific research needs.

Structure and Function of Dog PTH1R

Understanding the structure-function relationship of dog PTH1R is essential for comprehending its physiological role and potential as a research or therapeutic target.

Receptor Structure and Domains

Based on what is known about PTH1R in other species, the dog PTH1R likely contains several key structural domains:

DomainLocationFunction
N-terminal Extracellular DomainAmino terminusLigand binding
Transmembrane Domains (7)Spanning the cell membraneReceptor anchoring and signal transduction
Intracellular LoopsBetween transmembrane domainsG-protein coupling
C-terminal Cytoplasmic DomainCarboxyl terminusSignal regulation and receptor internalization

The search results indicate that bovine PTH1R spans amino acids 29-589 of the full protein , suggesting that the mature form of the receptor lacks a signal peptide (amino acids 1-28) that is cleaved during processing. A similar processing pattern would be expected for the canine receptor.

Physiological Functions in Dogs

In dogs, PTH1R mediates the effects of both PTH and PTHrP, which have partially overlapping but distinct physiological roles:

  1. Bone metabolism: PTH1R activation in osteoblasts and osteocytes regulates bone remodeling, increasing bone resorption during short-term activation and potentially promoting bone formation during intermittent activation.

  2. Calcium homeostasis: Through PTH signaling, PTH1R helps maintain serum calcium levels by increasing calcium resorption from bone, enhancing calcium reabsorption in the kidneys, and indirectly promoting intestinal calcium absorption.

  3. Phosphate handling: PTH1R activation leads to increased phosphate excretion by the kidneys, helping to balance serum phosphate levels.

  4. Development: During canine development, PTH1R plays crucial roles in skeletal formation and growth plate regulation through PTHrP signaling.

Applications and Research Significance of Recombinant Dog PTH1R

Recombinant dog PTH1R has significant potential applications in both research and clinical settings, particularly in the field of veterinary medicine.

Research Applications

Recombinant dog PTH1R can serve various research purposes:

  1. Structure-function studies to understand the specifics of ligand binding and signaling in canines

  2. Development of species-specific antibodies for detection and localization studies

  3. Screening platforms for identifying compounds that modulate PTH1R activity

  4. Comparative studies across species to identify evolutionary conserved and divergent features

These applications contribute to our fundamental understanding of calcium and bone physiology in dogs and potentially lead to novel therapeutic approaches for related disorders.

Potential Therapeutic Applications

Understanding dog PTH1R could lead to various therapeutic applications:

  1. Development of treatments for canine osteoporosis or other metabolic bone diseases

  2. Management of calcium-related disorders in dogs

  3. Potential applications in canine dental health, as PTH1R is involved in tooth development and maintenance

  4. Possible treatments for certain forms of canine hypercalcemia or hypocalcemia

Diagnostic Potential

Recombinant dog PTH1R and antibodies against it could potentially be used in developing diagnostic tools for:

  1. Detecting aberrant PTH1R expression in certain canine diseases

  2. Evaluating PTH/PTHrP signaling abnormalities in clinical samples

  3. Creating assays to measure PTH or PTHrP activity in canine patients

Reconstitution Protocols

For recombinant bovine PTH1R, the recommended reconstitution procedure involves:

  1. Brief centrifugation of the vial prior to opening

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of 5-50% glycerol (final concentration) for long-term storage

  4. Aliquoting for storage at -20°C/-80°C

Similar protocols would likely be appropriate for recombinant dog PTH1R.

Buffer Composition

The storage buffer for recombinant bovine PTH1R consists of a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . A similar buffer composition would likely be suitable for the canine recombinant protein, as this type of formulation helps maintain protein stability during storage.

Current Status of Dog PTH1R Research

While research on canine PTH1R appears limited based on the available search results, the general understanding of PTH1R across mammalian species provides a strong framework for future studies of the dog-specific receptor. The high degree of conservation in this receptor system suggests that many insights from human, bovine, mouse, and rat PTH1R research can inform our understanding of the canine equivalent, while still recognizing the need for species-specific research.

Future Research Directions

Several promising research directions for recombinant dog PTH1R include:

  1. Complete characterization of canine-specific PTH1R structure, ligand binding properties, and signaling pathways

  2. Development of dog-specific antibodies and detection tools

  3. Investigation of breed-specific variations in PTH1R structure or function

  4. Exploration of PTH1R's role in common canine skeletal and calcium-related disorders

  5. Potential development of therapeutic approaches targeting this receptor for veterinary applications

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PTH1R; PTH1; PTHR1; Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; PTH/PTHr receptor; Parathyroid hormone 1 receptor; PTH1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-595
Protein Length
Full Length of Mature Protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
DDVMTKEEQIFLLHRAQAQCQKRLKEVLQRPADIMESDKGWASASTSGKPKKEKASGKLY PESEEDKEVPTGSRHRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRC DRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLI LAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAVLYSGATLDEAERLTEEELRAIAQAP PPPTAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGW GLPAVFVAVWVSVRATLANTGCWDLSSGNKKWIIQVPILASIVLNFILFINIVRVLATKL RETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNS FQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVG PRAGLGLPLSPRLLPAAAATTTATTNGHPPIPGHTKPGAPTLPATPPATAAPKDDGFLNG SCSGLDEEASAPERPPALLQEEWETVM
Uniprot No.

Target Background

Function

This receptor mediates the actions of parathyroid hormone (PTH) and parathyroid hormone-related peptide (PTHrP). Its activity is coupled to G proteins, which activate both adenylyl cyclase and a phosphatidylinositol-calcium second messenger system.

Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
High levels in the kidney, with much lower levels in aorta, heart, lung, prostate, testis, and skeletal muscle.

Q&A

What is the basic structure of canine PTH1R and how does it compare to human PTH1R?

Canine PTH1R belongs to the class B G-protein-coupled receptor (GPCR) family with a characteristic seven-transmembrane structure . Like its human counterpart, canine PTH1R contains a large N-terminal extracellular domain that recognizes both parathyroid hormone (PTH) and parathyroid hormone-related protein (PTHrP) . The receptor shares significant structural homology with human PTH1R, making it valuable for comparative studies. The N-terminal domain plays a critical role in ligand recognition, while the transmembrane domain facilitates G-protein coupling and intracellular signaling activation.

When working with recombinant dog PTH1R, researchers should note that the receptor maintains high binding affinity for PTH(1-34) and PTHrP(1-36) across species, reflecting evolutionary conservation of this important signaling system . This characteristic enables cross-species experimental designs but requires careful consideration when interpreting binding and activation studies.

What are the primary signaling pathways activated by canine PTH1R?

Recombinant dog PTH1R primarily signals through two main pathways: the adenylyl cyclase/cAMP/protein kinase A pathway and the phospholipase C/inositol phosphate/protein kinase C pathway . In canine cells, PTH1R activation predominantly stimulates adenylyl cyclase, leading to increased intracellular cAMP levels and subsequent PKA activation . The phospholipase C pathway appears to be activated more weakly, suggesting a preference for cAMP-mediated signaling in canine tissues .

When designing experiments to study canine PTH1R signaling, researchers should include appropriate downstream signaling markers for both pathways. Phosphorylation of CREB (cAMP response element-binding protein) serves as an excellent marker for the activation of the adenylyl cyclase pathway in canine cells . Importantly, the relative contribution of each pathway may be tissue-dependent and influenced by the receptor's coupling preferences to different G proteins (Gs versus Gq), which should be accounted for in experimental designs.

What tissues express PTH1R in dogs and how does expression vary across development?

PTH1R is widely expressed in canine tissues with particularly high expression in bone and kidney, mirroring the expression pattern observed in other species . In canine bone tissue, PTH1R is predominantly expressed in osteoblasts and osteocytes, while renal expression is highest in the proximal tubules . Lower expression levels are found in various other tissues including vascular smooth muscle, dental mesenchymal cells, and specific brain regions .

During canine development, PTH1R expression is dynamically regulated, with peak expression observed during skeletal formation . For developmental studies, researchers should consider age-matched controls and account for the shifting expression patterns when designing sampling protocols. Quantitative PCR and immunohistochemistry remain the gold standards for measuring tissue-specific expression levels in canine samples, with appropriate housekeeping genes and antibody validation essential for reliable results.

What are the optimal expression systems for producing functional recombinant dog PTH1R?

For successful expression of functional recombinant dog PTH1R, mammalian expression systems generally yield superior results compared to bacterial or insect systems. HEK293 and CHO cell lines have proven particularly effective due to their appropriate post-translational modification capabilities . When establishing an expression system, researchers should consider the following methodological approach:

  • Codon optimization of the canine PTH1R sequence for the selected expression system

  • Inclusion of appropriate signal peptides for membrane localization

  • Addition of epitope tags (FLAG, HA, or His) that minimally interfere with receptor function

  • Development of stable cell lines using antibiotic selection for consistent expression

For functional assays, it is critical to verify proper membrane localization through confocal microscopy and confirm ligand binding capacity before proceeding with downstream experiments . Western blotting with glycosylation-sensitive approaches can help verify appropriate post-translational modifications of the recombinant receptor.

What are the recommended methods for detecting PTH1R expression in canine tissue samples?

Detection of PTH1R in canine tissue samples requires specific methodological considerations. Immunohistochemistry (IHC) has been successfully employed in numerous studies examining PTH1R in canine tissues, particularly in osteosarcoma samples . The following validated approach is recommended:

  • Tissue fixation in 10% neutral buffered formalin for 24-48 hours

  • Paraffin embedding and sectioning at 4-5 μm thickness

  • Antigen retrieval using citrate buffer (pH 6.0)

  • Blocking with 5% normal goat serum

  • Incubation with validated anti-PTH1R antibodies with confirmed cross-reactivity to canine PTH1R

  • Development using DAB (3,3'-diaminobenzidine) and counterstaining with hematoxylin

For quantification, researchers have employed a semi-quantitative scoring system ranging from weak to strong immunostaining intensity . This approach has demonstrated significant correlation with clinical outcomes in canine osteosarcoma patients, with strong PTH1R immunostaining associated with shorter survival times (212 days) compared to weak immunostaining (459 days) .

How can the functional activity of recombinant dog PTH1R be reliably measured?

Functional assessment of recombinant dog PTH1R should employ multiple complementary assays to provide comprehensive characterization. A methodological workflow should include:

  • cAMP accumulation assays: Using ELISA-based detection or FRET-based reporters to measure intracellular cAMP levels following stimulation with PTH or PTHrP peptides at varying concentrations (10^-12 to 10^-6 M)

  • Calcium mobilization assays: Using fluorescent calcium indicators (Fluo-4, Fura-2) to measure intracellular calcium release following receptor activation

  • ERK1/2 phosphorylation assays: Western blotting with phospho-specific antibodies to detect MAPK pathway activation downstream of PTH1R stimulation

  • Reporter gene assays: Using luciferase constructs containing cAMP-responsive elements (CRE) to assess transcriptional activation

For all functional assays, appropriate positive controls (forskolin for cAMP assays) and negative controls (untransfected cells) are essential. Dose-response curves should be generated to determine EC50 values, which typically range from 0.1-10 nM for PTH(1-34) and PTHrP(1-36) peptides in properly functioning recombinant systems .

PTH1R in Canine Disease Models

PTH1R signaling significantly influences canine dental mesenchymal stem cells (MSCs), modulating their proliferation, differentiation, and regenerative capacity . Dental MSCs express functional PTH1R and respond to both PTH and PTHrP stimulation through activation of downstream signaling cascades . The effects include:

  • Promotion of osteogenic differentiation through upregulation of osteoblastic markers

  • Enhancement of cell survival through anti-apoptotic mechanisms

  • Modulation of the balance between proliferation and differentiation

  • Influence on extracellular matrix production and mineralization

For dental tissue regeneration applications, intermittent PTH administration has shown promising results in promoting dental pulp repair and periodontal regeneration . Methodology for studying PTH1R in canine dental MSCs should include isolation of primary dental pulp stem cells, periodontal ligament stem cells, and dental follicle progenitor cells from canine samples, followed by characterization of PTH1R expression and functional responses to ligand stimulation .

When designing experiments, researchers should consider using both recombinant PTH(1-34) and PTHrP(1-36) peptides, as these ligands may elicit slightly different responses despite acting through the same receptor . Differentiation assays using osteogenic, adipogenic, and chondrogenic induction media can help assess how PTH1R signaling influences lineage commitment of canine dental MSCs.

What differences exist in PTH1R signaling between normal and pathological canine bone tissue?

PTH1R signaling exhibits notable differences between normal and pathological canine bone tissues, particularly in conditions like osteosarcoma and metabolic bone diseases. In normal canine bone, PTH1R signaling maintains a balanced regulation of bone formation and resorption through controlled activation of osteoblasts and indirect effects on osteoclasts . In pathological conditions, this balance is disrupted in several ways:

  • Expression levels: Pathological tissues often show aberrant PTH1R expression patterns, with osteosarcoma exhibiting heterogeneous but frequently elevated PTH1R levels

  • Signaling pathway preference: Normal bone tissue shows balanced activation of cAMP and phospholipase C pathways, while pathological tissues may show preferential activation of specific downstream pathways

  • Receptor coupling: In some pathological conditions, PTH1R may exhibit altered G-protein coupling preferences, shifting from Gs to Gi in certain contexts as observed in vascular smooth muscle cells from hypertensive rats

  • Response to ligands: Sensitivity to PTH and PTHrP may differ between normal and pathological tissues, affecting therapeutic response

Research approaches should include comparative signaling studies between normal and diseased tissues, with careful attention to downstream pathway activation. Phosphoproteomic analysis and transcriptional profiling following PTH1R stimulation can reveal disease-specific signaling signatures that may inform therapeutic targeting strategies.

How can recombinant dog PTH1R be utilized in drug discovery for bone disorders?

Recombinant dog PTH1R represents a valuable tool for preclinical drug discovery targeting bone disorders, particularly given the similarities between human and canine bone physiology and pathology. A methodological framework for utilizing recombinant dog PTH1R in drug discovery includes:

  • High-throughput screening: Establishing stable cell lines expressing dog PTH1R coupled to appropriate reporter systems (cAMP, calcium, β-arrestin recruitment) for screening compound libraries

  • Structure-activity relationship studies: Using recombinant receptor for binding and functional studies with modified PTH/PTHrP peptides or small molecule modulators

  • Biased signaling exploration: Identifying compounds that selectively activate specific PTH1R signaling pathways (G-protein vs. β-arrestin) to achieve desired therapeutic effects while minimizing side effects

  • Species-comparative pharmacology: Parallel testing of compounds against human and dog PTH1R to predict translational efficacy and identify species-specific responses

Recent studies have investigated PTH analogs in orofacial applications, suggesting potential therapeutic applications beyond traditional bone disorders . When developing screening assays, researchers should include appropriate controls including known PTH1R ligands (PTH and PTHrP) and established modulators of downstream signaling pathways to validate assay performance.

How can genetic manipulation of PTH1R expression be achieved in canine cell models?

Genetic manipulation of PTH1R in canine cell models requires selecting appropriate methodologies based on the specific research objectives. For successful manipulation, researchers should consider the following approach:

  • Transient knockdown: siRNA or shRNA targeting canine PTH1R mRNA, with careful design of target sequences based on the canine genome. Typically, 70-90% knockdown can be achieved with optimized transfection protocols

  • Stable knockdown/knockout: CRISPR/Cas9-mediated gene editing targeting the canine PTH1R gene, with careful guide RNA design to minimize off-target effects. This approach has been successfully employed in related studies and can achieve >95% reduction in expression

  • Overexpression systems: Lentiviral or adenoviral vectors carrying the canine PTH1R coding sequence with appropriate promoters for controlled expression. For inducible systems, tetracycline-responsive elements provide temporal control of expression

  • Domain-specific mutations: Site-directed mutagenesis to introduce specific mutations mimicking those found in human disorders (e.g., Jansen's metaphyseal chondrodysplasia) or to assess structure-function relationships

Verification of genetic manipulation should include mRNA quantification (qRT-PCR), protein expression analysis (Western blot), and functional assays to confirm altered receptor activity. For knockout validation, sequencing of the targeted genomic region is essential to confirm successful editing.

What experimental approaches are appropriate for studying PTH1R-mediated intracrine signaling in canine cells?

Studying PTH1R-mediated intracrine signaling in canine cells requires specialized experimental approaches that distinguish between classical membrane receptor signaling and nuclear/nucleolar actions of PTHrP. A comprehensive methodological approach includes:

  • Subcellular fractionation: Separation of membrane, cytoplasmic, nuclear, and nucleolar fractions followed by Western blot analysis to detect PTH1R and PTHrP localization in different cellular compartments

  • Confocal microscopy: Immunofluorescence staining with validated antibodies to visualize localization of PTH1R and PTHrP, particularly focusing on nuclear/nucleolar accumulation

  • Modified PTHrP constructs: Expression of PTHrP variants with mutated nuclear localization sequences (NLS) to disrupt intracrine pathways while maintaining paracrine signaling

  • Reporter systems: Nuclear-specific reporters to detect transcriptional changes induced by nuclear PTHrP that are independent of membrane PTH1R signaling

In canine vascular smooth muscle cells, PTHrP has been shown to exhibit paradoxical effects through an intracrine pathway involving nucleolar translocation, with proliferation inhibited in normal cells but stimulated in cells from hypertensive models . This presents a unique example of how a single molecule can have opposite effects under physiological versus pathophysiological conditions, highlighting the importance of studying intracrine signaling specifically in disease-relevant contexts.

How should researchers interpret contradictory findings regarding PTH1R roles in canine osteosarcoma?

Contradictory findings regarding PTH1R roles in canine osteosarcoma require careful methodological analysis and consideration of multiple factors that may explain discrepancies. When reconciling conflicting data, researchers should systematically evaluate:

  • PTHrP peptide fragment differences: Studies using different portions of the PTHrP sequence may yield contradictory results . N-terminal fragments (PTHrP 1-36) typically activate membrane PTH1R, while mid-region and C-terminal fragments may have distinct functions

  • Cell line heterogeneity: Different osteosarcoma cell lines or primary samples may represent distinct molecular subtypes with varying PTH1R expression and signaling characteristics

  • Temporal considerations: Acute versus chronic PTH1R activation may produce opposing effects, similar to the anabolic versus catabolic effects of intermittent versus continuous PTH administration in bone

  • Signaling pathway differences: PTH1R can couple to multiple G-proteins and activate diverse downstream pathways, which may be differentially regulated in various experimental contexts

  • Intracrine versus paracrine signaling: PTHrP can act through both membrane receptor-mediated and intracrine pathways, which may have opposing effects on cell proliferation and differentiation

To resolve contradictions, researchers should design experiments that systematically address these variables, using standardized methodology across different cell lines and primary samples. Meta-analysis approaches combining data from multiple studies can help identify patterns that explain seemingly contradictory results.

What statistical approaches are most appropriate for analyzing PTH1R expression data in canine tissue samples?

Analysis of PTH1R expression data in canine tissue samples requires appropriate statistical methodologies that account for the specific characteristics of the data. Recommended statistical approaches include:

  • For immunohistochemistry scoring: Non-parametric tests (Mann-Whitney U or Kruskal-Wallis) are most appropriate for semi-quantitative scoring systems (weak, moderate, strong immunostaining) . For survival analysis correlated with immunostaining intensity, Kaplan-Meier curves with log-rank tests provide reliable results, as demonstrated in canine osteosarcoma studies

  • For qRT-PCR data: After appropriate normalization with validated reference genes (GAPDH, 18S rRNA, β-actin for canine tissues), parametric tests (t-test, ANOVA) can be applied if normality assumptions are met. Otherwise, non-parametric alternatives should be employed

  • For multivariate analysis: Cox proportional hazards models allow integration of PTH1R expression data with other clinical variables (age, breed, tumor location, histological subtype) to assess independent prognostic value

  • For functional assays: Dose-response curves should be analyzed using nonlinear regression to determine EC50/IC50 values, with appropriate statistical comparisons of these parameters between experimental groups

Sample size calculation is critical, particularly for clinical studies. Based on previous canine osteosarcoma studies, a minimum of 20 samples per group is recommended to achieve sufficient statistical power (>0.8) for detecting clinically meaningful differences in survival outcomes based on PTH1R expression levels .

How can researchers distinguish between direct PTH1R-mediated effects and indirect consequences in canine experimental models?

Distinguishing direct PTH1R-mediated effects from indirect consequences requires carefully designed experimental approaches that isolate specific signaling components. Recommended methodological strategies include:

  • Pharmacological inhibitor studies: Using specific inhibitors of downstream signaling pathways (PKA inhibitors like H-89, PLC inhibitors like U73122) to block particular branches of PTH1R signaling and identify direct versus indirect effects

  • Receptor mutant approaches: Expressing mutant PTH1R variants with altered G-protein coupling preferences to selectively activate specific signaling pathways

  • Temporal signaling analysis: Conducting detailed time-course experiments to distinguish early (likely direct) versus late (potentially indirect) responses to PTH1R activation

  • Cell-specific knockout models: Using conditional knockout approaches targeting PTH1R in specific cell types to identify cell-autonomous versus non-cell-autonomous effects

  • Ex vivo organ culture systems: Utilizing canine bone or kidney explants to maintain tissue architecture while enabling controlled experimental manipulation of PTH1R signaling

For example, in studies of PTH1R effects on canine osteosarcoma, researchers found that blocking PTH1R reduced metastatic cell invasion, proliferation, migration, and adhesion, strongly suggesting these are direct receptor-mediated effects . Conversely, the influence of PTH1R on the tumor microenvironment and immune responses may represent indirect consequences that require more complex experimental paradigms to elucidate.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.