Recombinant Dog Phospholemman (FXYD1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Dog Phospholemman (FXYD1)

Recombinant Dog Phospholemman (FXYD1), also known as phospholemman, is a transmembrane protein engineered for research purposes. It belongs to the FXYD family of ion transport regulators, which modulate Na⁺/K⁺-ATPase activity in cardiac and skeletal tissues . This recombinant variant is derived from canine FXYD1 (UniProt ID: P56513) and is expressed in E. coli with an N-terminal His-tag for purification .

Key Attributes

ParameterDescription
SourceE. coli
TagHis-tag (N-terminal)
Protein LengthFull-length (21–92 amino acids)
Purity>90% (SDS-PAGE)
Amino Acid SequenceEAPQEHDPFTYDYQSLRIGGLIIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Functional Role and Mechanism

FXYD1 regulates Na⁺/K⁺-ATPase by modulating its ion affinity and pump activity. Key findings include:

  1. Phosphorylation-Dependent Regulation:

    • PKA phosphorylates serines 63 (S63) and 68 (S68) .

    • PKC phosphorylates S63, S68, and threonine 69 (T69) .

    • Phosphorylation alters Na⁺/K⁺-ATPase affinity for Na⁺ and K⁺, enhancing pump activity in response to β-adrenergic signals .

  2. Tissue-Specific Modulation:

    • In cardiac myocytes, FXYD1 associates with α1- and α2-isoforms of Na⁺/K⁺-ATPase, reducing internal Na⁺ affinity .

    • Deficiency in FXYD1 leads to reduced α2-isoform expression and impaired cardiac contractility .

Production and Quality Control

The recombinant dog FXYD1 is produced via bacterial expression and purified to high standards:

Production Parameters

ParameterDetail
Expression SystemE. coli
Purification MethodAffinity chromatography (His-tag)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid freeze-thaw cycles

Research Applications

This recombinant protein is widely used in studies of ion transport and cardiovascular function:

ApplicationExample Use Cases
SDS-PAGEPurity validation (observed molecular weight: 10–15 kDa)
Western BlottingDetection of phosphorylation status (e.g., S63/S68/T69 sites)
ImmunoprecipitationCo-IP with Na⁺/K⁺-ATPase subunits to study interactions
Patch-Clamp StudiesAnalysis of Na⁺/K⁺-ATPase currents in cardiac myocytes

Research Findings and Implications

  1. Cardiac Function: In FXYD1-deficient mice, Na⁺/K⁺-ATPase activity drops by 50%, leading to compensatory hypertrophy and increased ejection fraction .

  2. Epigenetic Regulation: DNA methylation at Fxyd1a inversely correlates with mRNA levels during heart development, suggesting tissue-specific epigenetic control .

  3. Oxidative Stress: Glutathionylation of FXYD1 modulates its interaction with Na⁺/K⁺-ATPase, impacting pump stability under oxidative conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
FXYD1; PLM; Phospholemman; FXYD domain-containing ion transport regulator 1; Sodium/potassium-transporting ATPase subunit FXYD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-92
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
EAPQEHDPFTYDYQSLRIGGLIIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Uniprot No.

Target Background

Function
Phospholemman (FXYD1) is a protein that associates with and regulates the activity of the sodium/potassium-transporting ATPase (NKA). This enzyme transports sodium ions (Na+) out of the cell and potassium ions (K+) into the cell. FXYD1 inhibits NKA activity in its unphosphorylated state, while stimulating activity when phosphorylated. It also reduces glutathionylation of the NKA beta-1 subunit ATP1B1, reversing glutathionylation-mediated inhibition of ATP1B1. Furthermore, FXYD1 contributes to female sexual development by maintaining the excitability of neurons that secrete gonadotropin-releasing hormone.
Database Links
Protein Families
FXYD family
Subcellular Location
Cell membrane, sarcolemma; Single-pass type I membrane protein. Apical cell membrane; Single-pass type I membrane protein. Membrane, caveola. Cell membrane, sarcolemma, T-tubule.
Tissue Specificity
Present in heart, esophagus, stomach, aorta, skeletal muscle, smooth muscle, and liver but absent from brain and kidney.

Q&A

What is phospholemman (FXYD1) and what is its primary function in cardiac tissue?

Phospholemman (FXYD1) is a member of the FXYD protein family that functions as a tissue-specific regulator of the Na+/K+-ATPase (sodium pump). It is primarily expressed in heart and skeletal muscle tissues where it serves as the predominant substrate for phosphorylation by protein kinase A (PKA) and protein kinase C (PKC) in cardiac sarcolemma . FXYD1 is unique among FXYD family members in having consensus phosphorylation sites for PKA and PKC in its intracellular region .

The primary function of FXYD1 is to regulate the activity of Na+/K+-ATPase by modulating its apparent affinity for Na+ and K+. Studies with FXYD1-deficient mice have demonstrated that FXYD1 is essential for β-adrenergic and PKC-mediated regulation of the Na+/K+-ATPase, as these regulatory pathways are absent in FXYD1-knockout models .

What are the key phosphorylation sites in dog FXYD1?

The key phosphorylation sites in dog FXYD1 include:

  • Serine 63 (S63) - phosphorylated by both PKA and PKC

  • Serine 68 (S68) - phosphorylated by both PKA and PKC

  • Threonine 69 (T69) - phosphorylated specifically by PKC

These phosphorylation sites have been confirmed through multiple experimental techniques including HPLC analysis, mass spectrometry, and Edman sequencing of FXYD1 peptides phosphorylated in the presence of γ³²P-ATP . In unstimulated cardiac myocytes, FXYD1 is approximately 30% phosphorylated at S63 and S68, but barely phosphorylated at T69 .

How do different transcript isoforms of FXYD1 vary during development?

FXYD1 is expressed as multiple transcript isoforms, with Fxyd1a and Fxyd1b being the two primary variants identified in mouse studies. These isoforms show distinct tissue-specific expression patterns during development that are regulated by epigenetic mechanisms .

DNA methylation analysis has revealed that the expression of these transcript isoforms inversely correlates with DNA methylation in developing brain and cardiac tissues. Specifically:

  • DNA methylation at Fxyd1a increases during brain development but decreases during heart development

  • These methylation changes correspond with inverse changes in mRNA expression levels

  • Ultra-deep methylation analysis has identified distinct methylation profiles (epialleles) between heart and brain and across different developmental stages

This epigenetic regulation suggests differential roles for these isoforms in tissue-specific contexts during development.

How does PKA phosphorylation affect FXYD1 function in regulating Na+/K+-ATPase?

PKA phosphorylation of FXYD1, primarily at serine 68 (S68), has significant effects on Na+/K+-ATPase function in a tissue-specific manner. Studies using the Xenopus oocyte expression system have shown that:

  • PKA phosphorylation does not affect the maximal transport activity of Na+/K+-ATPase α1/β1 and α2/β1 isozymes

  • It does not alter the apparent K+ affinity of these isozymes

  • It significantly increases their apparent Na+ affinity, dependent on FXYD1 phosphorylation at S68

This increased Na+ affinity enhances Na+/K+-ATPase activity at physiological intracellular Na+ concentrations, which can affect cardiac contractility by modulating intracellular Na+ levels and, indirectly, Ca2+ homeostasis through the Na+/Ca2+ exchanger (NCX1) .

How does PKC phosphorylation of FXYD1 differ from PKA phosphorylation in its effects?

PKC phosphorylation of FXYD1 has isozyme-specific effects on Na+/K+-ATPase function that differ from those of PKA phosphorylation:

ParameterPKA PhosphorylationPKC Phosphorylation
Phosphorylation SitesS63, S68S63, S68, T69
Effect on α1/β1 Maximal ActivityNo changeNo change
Effect on α2/β1 Maximal ActivityNo changeIncreased
Effect on Apparent K+ AffinityNo changeNo change
Effect on Apparent Na+ AffinityIncreasedComplex effects
MechanismAlters Na+ bindingIncreases turnover number for α2/β1

PKC phosphorylation of FXYD1 increases the maximal Na+/K+-pump current of α2/β1 isozymes by increasing their turnover number, while having minimal effects on α1/β1 isozymes . This isozyme-specific regulation suggests that PKC phosphorylation of FXYD1 may have distinct functional consequences depending on the Na+/K+-ATPase isozyme composition in different cardiac cell types or regions.

What is the significance of the newly identified threonine 69 phosphorylation site?

Threonine 69 (T69) represents a newly identified phosphorylation site in FXYD1 that is specifically targeted by PKC but not PKA . This site has several unique characteristics:

  • In unstimulated cardiac myocytes, FXYD1 is barely phosphorylated at T69, unlike S63 and S68 which show approximately 30% basal phosphorylation

  • Phosphospecific antibodies (CP69 for T69 phosphorylation and CP689 for dual S68/T69 phosphorylation) have been developed to study this site

  • These antibodies require careful blocking with unphosphorylated peptide antigens to ensure specificity

The functional significance of T69 phosphorylation appears to be related to fine-tuning Na+/K+-ATPase activity in response to specific signaling pathways, potentially providing an additional layer of regulation beyond the more well-characterized S63 and S68 phosphorylation sites.

What expression systems are most effective for producing recombinant dog FXYD1?

For recombinant dog FXYD1 expression, several systems have been successfully employed depending on the experimental goals:

  • E. coli expression system: Effective for producing the intracellular region of FXYD1 as a glutathione S-transferase (GST) fusion protein. The fusion protein can be purified using standard techniques, and the GST affinity tag subsequently removed by thrombin cleavage .

  • Xenopus oocyte system: Particularly useful for functional studies, as it allows co-expression of FXYD1 with Na+/K+-ATPase and electrophysiological measurement of pump activity. This system has been successfully used to characterize the effects of PKA and PKC phosphorylation on FXYD1 regulation of different Na+/K+-ATPase isozymes .

  • Viral vector systems: For in vivo studies, recombinant adeno-associated virus serotype 9 (rAAV9) has been successfully used to express FXYD1 mutants (such as phosphomimetic S68E) in mouse hearts .

The choice of expression system should be guided by the specific research question, with prokaryotic systems offering higher yields but eukaryotic systems providing better protein folding and post-translational modifications.

How can phosphomimetic mutants of FXYD1 be generated and validated?

Phosphomimetic mutants of FXYD1, such as the S68E mutant, can be generated using site-directed mutagenesis to replace serine or threonine residues with glutamate (E), which mimics the negative charge of a phosphorylated residue. The procedure involves:

  • Mutant construction: The coding sequence of canine cardiac PLM S68E mutant can be prepared by PCR and subcloned into an appropriate vector (e.g., pTRαCARD for viral expression) .

  • Expression verification: Western blotting with antibodies that recognize the species-specific FXYD1 (e.g., B8 antibody recognizes dog but not rat or mouse PLM) can confirm expression .

  • Expression level assessment: Using antibodies that recognize FXYD1 across species (e.g., C2 antibody recognizes the COOH termini of dog, rat, mouse, rabbit, pig, and human PLM), the expression level of the mutant can be compared to endogenous levels to ensure physiological relevance .

  • Functional validation: The mutant should be tested for its ability to reproduce the effects of phosphorylated wild-type FXYD1, such as inhibition of NCX1 current in HEK293 cells or changes in cardiac contractility in vivo .

What techniques are most effective for analyzing FXYD1 phosphorylation states?

Several techniques have proven effective for analyzing FXYD1 phosphorylation states:

  • Phosphospecific antibodies: Antibodies that specifically recognize FXYD1 phosphorylated at S63, S68, T69, or combinations thereof are valuable tools. For example:

    • CP69 antibody for T69 phosphorylation

    • CP689 antibody for dual S68/T69 phosphorylation

  • HPLC analysis: Phosphorylated peptides can be separated from non-phosphorylated forms by HPLC, allowing quantification of phosphorylation stoichiometry .

  • Mass spectrometry: MALDI-TOF analysis can confirm that peptide masses are consistent with predicted phosphorylation stoichiometries .

  • Edman sequencing with radiolabeled ATP: In vitro phosphorylation using γ-³²P-ATP followed by Edman sequencing can pinpoint exactly which residues are phosphorylated by specific kinases .

  • Immunoblotting with phosphospecific antibodies: This approach can be used to monitor phosphorylation in cellular contexts, such as cultured adult rat ventricular myocytes treated with PKA and PKC agonists .

How can viral vectors be optimized for in vivo FXYD1 studies?

For in vivo FXYD1 studies, viral vectors (particularly rAAV9) can be optimized through several strategies:

  • Vector construction: The coding sequence of wild-type or mutant FXYD1 (e.g., S68E) along with untranslated regions (5'-UTR: 60 bp; 3'-UTR: 200 bp) should be subcloned into a suitable viral vector plasmid such as pTRαCARD .

  • Purification protocol: A rigorous purification protocol is essential:

    • Triple transfection of HEK293 cells with the FXYD1-containing plasmid and helper plasmids

    • Cell collection and sonication

    • DNase I treatment

    • PEG precipitation

    • Two rounds of cesium chloride gradient ultracentrifugation

    • Dialysis against appropriate buffer

  • Delivery methods:

    • Direct cardiac injection: The purified virus can be directly injected into the anterior and posterior left ventricular wall and the apex

    • Systemic delivery: Tail vein or retroorbital sinus injection can provide broader distribution

  • Expression verification: GFP co-expression can be used to visually confirm successful transduction, with approximately 40% of myocytes from directly injected hearts showing GFP fluorescence .

  • Quantification of expression: Western blotting with appropriate antibodies should be used to verify that the expression level is not supraphysiological to avoid disturbing the normal stoichiometry of FXYD1 interactions .

How can researchers address species-specific antibody reactivity when studying FXYD1?

Species-specific antibody reactivity is a significant challenge in FXYD1 research. To address this issue:

  • Use species-specific antibodies: For example, B8 antibody recognizes the NH₂ terminus of dog but not rat or mouse PLM, while C2 antibody recognizes the COOH termini of FXYD1 across multiple species (dog, rat, mouse, rabbit, pig, and human) .

  • Include appropriate controls: When using phosphospecific antibodies, include blocking peptides:

    • Unphosphorylated peptide antigen to neutralize antibodies that might recognize unphosphorylated FXYD1

    • Additional blocking peptides with specific phosphorylation patterns (e.g., IRRLSTRRR and IRRLSTRRR) when using antibodies like CP689 that recognize dual phosphorylation

  • Consider cross-reactivity assumptions: When comparing expression levels between species, be aware that antibodies may not have equal reactivity against FXYD1 from different species, even if the epitope is highly conserved .

  • Validate with multiple techniques: Complement antibody-based detection with other techniques such as mass spectrometry or functional assays that are less affected by species differences.

What considerations are important when interpreting data from FXYD1 knockout and rescue experiments?

When interpreting data from FXYD1 knockout and rescue experiments, several factors should be considered:

  • Baseline characteristics: Confirm that there are no compensatory changes in the expression of related proteins (NCX1, α₁- and α₂-subunits of Na⁺-K⁺-ATPase, SERCA2, calsequestrin) in the knockout model .

  • Expression level of rescue construct: The level of expression of the rescue construct (e.g., S68E mutant) should be quantified relative to physiological levels of endogenous PLM in wild-type hearts to avoid artifacts from over- or under-expression .

  • Transduction efficiency: In viral-mediated rescue experiments, consider that not all cells will be transduced. Approximately 40% transduction efficiency has been reported for direct cardiac injection, which may result in an underestimation of the rescue effect .

  • Phosphomimetic limitations: Recognize that phosphomimetic mutations (e.g., S68E) may not perfectly replicate the effects of phosphorylation. While the S68E mutant reproduces the inhibitory effects of forskolin on NCX1 current in HEK293 cells, the negative charge of glutamate does not exactly match that of a phosphate group .

  • Functional readouts: Use multiple functional readouts (e.g., echocardiography and hemodynamic measurements) to comprehensively assess the rescue effect .

What are common challenges in purifying functional recombinant FXYD1?

Researchers face several challenges when purifying functional recombinant FXYD1:

  • Protein solubility: As a membrane protein, FXYD1 can have solubility issues. Using fusion partners like GST can enhance solubility for the intracellular region, but the full-length protein may require detergent-based extraction methods .

  • Maintaining phosphorylation state: Endogenous phosphatases may dephosphorylate FXYD1 during purification. S63 and S68 are rapidly dephosphorylated following acute inhibition of PKC in unstimulated cells, indicating active regulation that must be controlled during purification .

  • Purification of viral vectors: For rAAV9-FXYD1 constructs, the purification process is complex, involving multiple steps:

    • PEG precipitation

    • Sarkosyl treatment

    • Two rounds of cesium chloride gradient ultracentrifugation

    • Careful selection of peak fractions by refractive index (density ~1.42 g/cm³)

    • Dialysis against appropriate buffer

  • Verification of purity and identity: Confirming the identity and purity of the purified protein requires multiple techniques including Western blotting with specific antibodies, mass spectrometry, and functional assays .

How can researchers overcome the signal-to-noise ratio challenges in whole-animal FXYD1 studies?

Signal-to-noise ratio challenges in whole-animal FXYD1 studies can be addressed through several approaches:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.