Recombinant Dog Potassium voltage-gated channel subfamily A member 2 (KCNA2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice packaging, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
KCNA2; Potassium voltage-gated channel subfamily A member 2; CSMK1; Voltage-gated potassium channel subunit Kv1.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-499
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
KCNA2
Target Protein Sequence
MTVATGEPADEAAALPGHPQDTYDPEADHECCERVVTNISGLRFETQLKTLAQFPETLLG DPKKRMRFFDPLRNEIFFVRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPS IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA NCTLANTNYVNITKMLTDV
Uniprot No.

Target Background

Function
Recombinant Dog Potassium voltage-gated channel subfamily A member 2 (KCNA2) is a voltage-gated potassium channel that facilitates transmembrane potassium transport in excitable membranes. It plays a crucial role in the brain and central nervous system, as well as the cardiovascular system. Its primary function is to prevent aberrant action potential firing and regulate neuronal output. KCNA2 forms tetrameric potassium-selective channels, allowing potassium ions to pass through in accordance with their electrochemical gradient. The channel undergoes transitions between open and closed conformations in response to voltage differences across the membrane. It can form functional homotetrameric channels and heterotetrameric channels containing varying proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and potentially other family members. The specific channel properties are determined by the composition of alpha subunits. Cytoplasmic beta subunits modulate channel properties by regulating the subcellular location of alpha subunits and promoting rapid inactivation of delayed rectifier potassium channels. In vivo, membranes likely contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to a specific potassium channel family member. Homotetrameric KCNA2 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous closure. In contrast, a heteromultimer composed of KCNA2 and KCNA4 exhibits rapid inactivation. KCNA2 plays a significant role in regulating neuronal excitability and acting as a pacemaker in the control of neuronal action potentials. KCNA2-containing channels are presynaptic and prevent hyperexcitability and aberrant action potential firing. The response to toxins specific to KCNA2-containing potassium channels suggests that in Purkinje cells, dendritic subthreshold KCNA2-containing potassium channels prevent random spontaneous calcium spikes, suppressing dendritic hyperexcitability without impeding the generation of somatic action potentials. This function is essential for motor coordination. KCNA2 participates in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus. It may function as a downstream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. Additionally, KCNA2 may contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA). It also contributes to the regulation of axonal release of the neurotransmitter dopamine. Reduced KCNA2 expression plays a role in neuropathic pain perception after peripheral nerve injury but not in acute pain. KCNA2 participates in the regulation of time spent in non-rapid eye movement (NREM) sleep.
Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.2/KCNA2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane. Cell projection, axon. Cell junction, synapse. Cell junction, synapse, presynaptic cell membrane. Cell junction, synapse, synaptosome. Endoplasmic reticulum membrane. Cell projection, dendrite. Cell projection, lamellipodium membrane. Cell junction, paranodal septate junction.
Tissue Specificity
Expressed in a wide variety of gastrointestinal smooth muscles. Not expressed in portal vein, renal artery, and uterus.

Q&A

Basic Structure and Function Questions

1.1. What is the molecular structure of canine KCNA2 and how does it compare to other mammalian species?

Canine KCNA2 belongs to the Shaker subfamily of voltage-gated potassium channels. The protein consists of six transmembrane segments (S1-S6) with the S4 segment serving as the primary voltage sensor containing positively charged amino acid residues. The S5-S6 regions form the channel pore. Comparative analysis across species shows high conservation, particularly in the voltage sensor domain (VSD) and pore regions.

For effective structural characterization, researchers should employ a combination of:

  • X-ray crystallography or cryo-EM for detailed structural analysis

  • Homology modeling based on highly conserved regions from resolved mammalian KCNA2 structures

  • Molecular dynamics simulations to analyze conformational changes during gating

While specific dog KCNA2 structural data is limited, researchers can leverage the high sequence homology with mouse KCNA2, which spans 499 amino acids with critical functional domains including the PVP motif in the S6 region that is highly conserved across species .

1.2. How should researchers design expression systems for functional recombinant dog KCNA2?

When expressing recombinant dog KCNA2, consider the following methodological approach:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, cost-effectiveLimited post-translational modificationsStructural studies, antibody production
Mammalian cells (HEK293/COS-7)Native-like folding and modificationsLower yield, higher costFunctional studies, electrophysiology
Insect cellsGood compromise between yield and modificationsModerate costProtein-protein interaction studies

For functional studies, mammalian expression systems are recommended as they support proper tetrameric assembly of KCNA2 subunits. Using vectors with fluorescent tags (e.g., EGFP) can facilitate monitoring of expression efficiency and subcellular localization, similar to approaches used with mouse KCNA2 . For purification, incorporate an N-terminal His-tag followed by affinity chromatography, as demonstrated with mouse Kcna2 protein expression in E. coli .

Advanced Experimental Methods

2.1. What electrophysiological techniques are most appropriate for characterizing recombinant dog KCNA2 function?

Comprehensive functional characterization of recombinant dog KCNA2 requires multiple electrophysiological approaches:

  • Whole-cell patch clamp: Ideal for measuring macroscopic currents, activation/inactivation kinetics, and voltage dependence. Use voltage protocols that step from holding potentials of -80mV to +60mV in 10mV increments to generate IV curves.

  • Inside-out patch: Valuable for studying channel modulation by intracellular factors such as phosphorylation or pH changes.

  • Voltage clamp fluorometry (VCF): This technique combines electrophysiological recording with fluorescence measurements by introducing a cysteine mutation (such as A291C in rat KCNA2) to allow fluorophore attachment . This enables tracking of voltage sensor movements during channel gating, providing insights into the conformational changes underlying channel function.

Analysis should include quantification of:

  • Activation and inactivation time constants

  • Voltage dependence of activation (V₁/₂)

  • Recovery from inactivation

  • Single-channel conductance

2.2. How can researchers effectively analyze mutations in dog KCNA2 and their functional consequences?

When analyzing KCNA2 mutations:

  • Site-directed mutagenesis approach:

    • Design primers targeting conserved regions like the PVP motif or S4 segment

    • Confirm mutations by sequencing before functional studies

    • Generate both homozygous and heterozygous expression systems to evaluate dominant negative effects

  • Functional characterization workflow:

    • Compare wild-type and mutant channel properties using standardized voltage protocols

    • Assess for both gain-of-function and loss-of-function effects

    • Co-express wild-type and mutant subunits to evaluate heteromeric channel properties

    • Quantify changes in current density, voltage-dependent activation/inactivation, and kinetic parameters

  • Biophysical assessment techniques:

    • Molecular dynamics simulations to predict structural changes

    • Evaluate altered VSD exposure to membrane lipids

    • Track conformational rearrangements using fluorescence techniques

Research on human KCNA2 variants shows that mutations like F302L in the S4 segment can simultaneously cause gain-of-function (channel opening at more hyperpolarized potentials) and loss-of-function (accelerated inactivation) effects, which may not be fully rescued by coexpression with wild-type subunits .

KCNA2 in Disease Models and Therapeutic Approaches

3.1. What are the methodological considerations for studying dog KCNA2 in epilepsy models?

When investigating dog KCNA2 in epilepsy models:

  • In vitro neuronal models:

    • Primary canine neuronal cultures

    • Transfection of dog KCNA2 variants into rat cortical neurons for comparative analysis

    • Assessment of action potential duration, early afterdepolarization, and potassium current density

  • Parameters to quantify:

    • Action potential broadening

    • Early afterdepolarization (EAD) frequency

    • Changes in repolarizing potassium current

  • Experimental design considerations:

    • Control for heterozygous versus homozygous expression

    • Consider dominant negative effects through hetero-tetrameric assembly

    • Analyze both acute and chronic effects on neuronal excitability

Human KCNA2 research demonstrates that mutations can lead to broadening of action potential duration and early afterdepolarization, associated with reduced potassium current . Similar methodological approaches should be applied when studying dog KCNA2 variants.

3.2. How can antisense oligonucleotide therapies be designed and evaluated for dog KCNA2 mutations?

For designing antisense oligonucleotide (ASO) therapies targeting mutant dog KCNA2:

  • Design methodology:

    • Identify mutation-specific sequences amenable to ASO targeting

    • Design Gapmer ASOs with central DNA region flanked by modified RNA segments

    • Optimize sequence specificity to differentiate between wild-type and mutant mRNA by 1-3 nucleotides

    • Perform in silico screening for potential off-target effects

  • Delivery system optimization:

    • Evaluate lipid nanoparticle (LNP) formulations for neuronal delivery

    • Assess biodistribution in relevant tissues

    • Determine optimal dosing regimens

  • Efficacy assessment:

    • Quantify selective knockdown of mutant versus wild-type KCNA2 mRNA and protein

    • Measure restoration of channel function using electrophysiology

    • Assess normalization of neuronal excitability parameters

Human studies demonstrate that Gapmer ASOs can selectively target mutation-specific sequences like c.1220C>G in KCNA2, allowing degradation of mutant mRNA while preserving wild-type KCNA2 expression . These approaches have shown promise in reversing electrophysiological abnormalities in neurons expressing dominant negative KCNA2 variants.

Advanced Research Techniques and Future Directions

4.1. What molecular techniques are recommended for tracking KCNA2 trafficking and membrane localization?

To investigate trafficking and membrane localization of dog KCNA2:

  • Surface expression quantification:

    • Incorporate extracellular epitope tags (e.g., HA-tag) accessible to antibodies without permeabilization

    • Use flow cytometry to quantify membrane versus total expression

    • Implement biotinylation assays to isolate surface proteins

  • Live-cell imaging approaches:

    • Employ N-terminal EGFP fusion constructs to visualize trafficking dynamics

    • Use total internal reflection fluorescence (TIRF) microscopy to focus on membrane-proximal regions

    • Apply fluorescence recovery after photobleaching (FRAP) to assess mobility within the membrane

  • Colocalization analysis:

    • Quantify overlap with markers for different cellular compartments (ER, Golgi, plasma membrane)

    • Evaluate interactions with trafficking proteins using proximity ligation assays

Research with human KCNA2 variants has shown that certain mutations do not affect membrane trafficking but rather alter channel function after proper localization . For example, the F302L mutation in human KCNA2 does not impair membrane localization as assessed by flow cytometry of HA-tagged constructs in COS-7 cells .

4.2. How should researchers approach heteromeric channel formation between dog KCNA2 and other KV channel subunits?

When studying heteromeric channel assembly:

  • Co-expression experimental design:

    • Implement controlled ratios of KCNA2 with other KV1 family members (KV1.1, KV1.4, etc.)

    • Use differentially tagged subunits to track individual components

    • Establish stable cell lines with inducible expression systems for consistent results

  • Interaction analysis methods:

    • Co-immunoprecipitation to confirm physical association

    • Förster resonance energy transfer (FRET) to measure proximity in live cells

    • Blue native PAGE to visualize intact channel complexes

  • Functional impact assessment:

    • Record from cells expressing defined subunit combinations

    • Create calibration curves relating subunit ratios to functional parameters

    • Analyze dominant effects of mutant subunits on heteromeric channel properties

Research on human KCNA2 demonstrates that mutant KV1.2_P407R subunits can suppress both KV1.2 and KV1.1 channel activities through hetero-tetrameric assembly, suggesting dominant negative effects extend to related channel subunits .

KV Channel CombinationTypical Current Density (pA/pF)Activation V₁/₂ (mV)Inactivation Time Constant (ms)
KCNA2 homomeric150-200-30 to -202000-3000
KCNA2/KCNA1 (1:1)120-180-35 to -251500-2500
KCNA2/KCNA4 (1:1)100-140-25 to -15500-1000
KCNA2-mutant homomeric30-70VariableOften accelerated

Comparative Analysis and Translational Potential

5.1. How do findings from dog KCNA2 studies translate to human KCNA2-related disorders?

When evaluating translational potential:

  • Cross-species sequence analysis methodology:

    • Perform multiple sequence alignment focusing on functional domains

    • Identify conserved residues in critical regions (PVP motif, voltage sensor)

    • Map known pathogenic variants across species

  • Comparative electrophysiology approach:

    • Record from cells expressing species-specific KCNA2 variants under identical conditions

    • Standardize analysis parameters to facilitate direct comparisons

    • Calculate correlation coefficients for key biophysical properties

  • Validation in disease-relevant contexts:

    • Test pharmaceutical interventions on both dog and human KCNA2 variants

    • Evaluate response similarities in neuronal expression systems

    • Correlate in vitro findings with clinical phenotypes when possible

Mutations in conserved regions like the PVP motif (e.g., P407R in human KCNA2) highlight the potential for dog models to inform human therapeutic development . The high conservation of voltage-sensing domains across species suggests similar pathophysiological mechanisms may operate in dog and human KCNA2-related disorders.

5.2. What are the recommended methods for investigating the impact of dog KCNA2 mutations on neuronal network activity?

To study network effects:

  • Neuronal culture systems:

    • Develop dog-derived neuronal cultures where possible

    • Create multi-electrode array (MEA) recordings to analyze network-level changes

    • Compare spontaneous versus evoked activity patterns

  • iPSC-derived neuronal models:

    • Generate induced pluripotent stem cells from affected dogs

    • Differentiate into relevant neuronal subtypes

    • Characterize network formation and synchronization

  • Analysis parameters:

    • Burst frequency and duration

    • Network synchronization indices

    • Propagation patterns and velocities

    • Pharmacological response profiles

Studies with human KCNA2 variants demonstrate that expression of mutant channels in cortical neurons can significantly alter neuronal excitability, suggesting network-level consequences that could contribute to epileptogenesis . Similar methodological approaches should be implemented when investigating dog KCNA2 variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.