Recombinant Dog Probable palmitoyltransferase ZDHHC8 (ZDHHC8)

What is the functional role of ZDHHC8 in cellular processes?

ZDHHC8 functions as a palmitoyltransferase that catalyzes the addition of palmitate to specific protein substrates through a post-translational modification process called palmitoylation. This modification is reversible and regulates diverse cellular functions, potentially affecting protein localization, stability, and activity. In Drosophila models, ZDHHC8 has been identified as regulating tissue growth, with its knockdown leading to tissue overgrowth due to increased cell proliferation . The enzyme appears to function as a tissue-autonomous inhibitor of cell proliferation, suggesting it may play roles in maintaining appropriate tissue size and preventing hyperplasia.

ZDHHC8 demonstrates substrate specificity, with research identifying potential targets including scribble, a tumor suppressor protein involved in cell polarity, and Ras64B, which plays roles in growth control pathways . The enzyme contains a DHHC domain, which is characteristic of palmitoyltransferases and essential for catalytic activity. This conservation across species from Drosophila to mammals indicates ZDHHC8's fundamental importance in biological systems.

How is ZDHHC8 expression regulated in different tissues and developmental stages?

ZDHHC8 expression varies across tissues, with particularly high expression observed in brain tissue . Expression regulation appears to be complex and context-dependent. In developmental contexts, complete loss of ZDHHC8 function in Drosophila models is lethal at the larval stage, specifically around the transition from larval stage 2 to 3, indicating its essential role in development . ZDHHC8 knockout larvae exhibit defects in molting, growth retardation, and metabolic abnormalities, including reduced body weight and decreased triglyceride levels.

Expression patterns of ZDHHC8 correlate with disease states in interesting ways. In cancer, ZDHHC8 expression shows complex relationships with prognosis that are cancer-type dependent. High expression correlates with shorter survival in renal and cervical cancers, while conversely associating with longer survival in lung and pancreatic cancers . This suggests tissue-specific functions and regulatory mechanisms that warrant further investigation to understand the contextual role of ZDHHC8 in different biological settings.

What are the known protein substrates of ZDHHC8 and how are they identified?

Researchers have identified several protein substrates of ZDHHC8 through a combination of biochemical and genetic approaches. In Drosophila models, Acyl-Biotin Exchange Mass Spectrometry (ABE-MS) has been employed to identify proteins with reduced palmitoylation in ZDHHC8 knockout samples . This technique involves exchanging palmitate modifications with biotin, followed by affinity purification and mass spectrometry identification.

Two significant substrates identified and validated include:

• Scribble: This tumor suppressor protein was confirmed as a ZDHHC8 substrate through Acyl-Biotin Exchange Western Blotting (ABE-WB), which demonstrated decreased palmitoylated scribble in ZDHHC8 knockout animals compared to controls . Scribble is involved in cell polarity regulation and functions in the Hippo signaling pathway.

• Ras64B: This growth regulator was identified as having reduced palmitoylation in ZDHHC8 knockout animals, with genetic interaction studies showing that Ras64B overexpression enhances ZDHHC8 mutant lethality . Further validation using ABE-WB demonstrated decreased palmitoylated Ras64B in knockout animals.

Beyond these, researchers identified a list of 13 potential ZDHHC8 targets showing at least 40% decrease in palmitoylation in knockout samples, though these differences did not reach statistical significance in initial studies . Substrate identification remains an active area of research to fully understand ZDHHC8's biological functions.

What are the optimal conditions for expressing and purifying recombinant dog ZDHHC8?

Recombinant full-length dog ZDHHC8 protein can be effectively expressed using bacterial expression systems, particularly E. coli, with an N-terminal His-tag for purification purposes . The full-length protein consists of 765 amino acids, with the recombinant version typically including a His-tag to facilitate purification via affinity chromatography .

The amino acid sequence of ZDHHC8 contains characteristic features of palmitoyltransferases, including the DHHC motif within the catalytic domain. The specific sequence starting with "MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLANFSMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGR" encompasses key functional regions of the protein .

Optimal expression conditions typically involve careful temperature control, as membrane-associated proteins like ZDHHC8 can be challenging to express in soluble form. The protein is typically supplied as a lyophilized powder after purification, suggesting that lyophilization is an effective method for long-term storage . When designing expression systems for ZDHHC8, researchers should consider codon optimization for the expression host and include appropriate solubilization strategies for this membrane-associated enzyme.

How can researchers effectively measure ZDHHC8 activity in experimental settings?

Measuring ZDHHC8 enzymatic activity requires specialized assays that detect palmitoylation of substrate proteins. Several established methodologies include:

• Acyl-Biotin Exchange (ABE) assay: This technique has been successfully applied to measure ZDHHC8 activity by detecting palmitoylated proteins in both Western blot (ABE-WB) and mass spectrometry (ABE-MS) formats . The process involves:

  • Blocking free thiols with N-ethylmaleimide

  • Cleaving thioester bonds with hydroxylamine

  • Biotinylating newly exposed thiols

  • Enriching biotinylated proteins and detecting by Western blot or mass spectrometry

• ELISA-based detection: ELISA kits specifically designed for dog ZDHHC8 offer a sensitive method for detecting the enzyme itself, with reported standard deviation less than 8% for standards repeated 20 times on the same plate and less than 10% when samples are measured by different operators . These kits show high specificity with no significant cross-reactivity with analogues.

• Functional assays: Researchers can assess ZDHHC8 activity by measuring the palmitoylation status of known substrates such as scribble or Ras64B using ABE-WB . Changes in substrate palmitoylation following ZDHHC8 manipulation (knockdown, knockout, or overexpression) provide indirect measures of enzyme activity.

For in vivo assessment, genetic approaches using RNA interference or CRISPR-based gene editing have been effective in Drosophila models, with phenotypic readouts including tissue growth, metabolism, and development serving as functional indicators of ZDHHC8 activity .

What are the key considerations for designing ZDHHC8 knockdown or knockout experiments?

When designing experiments to manipulate ZDHHC8 expression, researchers should consider several critical factors:

• Model selection and specificity:

  • Different model systems may yield divergent results. In Drosophila, tissue-specific ZDHHC8 knockdown causes overgrowth, while systemic knockout results in lethality and metabolic defects . This discrepancy suggests that experimental design should account for tissue-specific versus systemic effects.

  • Ensure knockdown specificity by using appropriate controls and validating with antibodies against ZDHHC8, as successfully done in Drosophila studies .

• Phenotypic analysis approaches:

  • Include morphological assessment: In Drosophila, ZDHHC8 knockout larvae exhibit defects in molting, growth retardation, and metabolic abnormalities .

  • Measure metabolic parameters: ZDHHC8 knockout larvae show reduced body weight and decreased triglyceride levels .

  • Assess developmental timing: ZDHHC8 knockouts die around the transition from larval stage 2 to 3, indicating specific developmental checkpoints requiring ZDHHC8 function .

• Functional compensation and dose-dependency:

  • Consider potential compensatory mechanisms from other palmitoyltransferases in knockdown versus knockout approaches.

  • Titrate knockdown levels, as mild knockdown versus complete knockout can yield dramatically different phenotypes, as observed with ZDHHC8 and other genes like TSC2 .

• Molecular readouts:

  • Assess palmitoylation status of target proteins using ABE-WB or ABE-MS techniques .

  • In neuronal models, evaluate electrophysiological parameters, as ZDHHC8 affects neuronal excitability and seizure susceptibility .

Clone tracing techniques using markers like GFP for ZDHHC8 knockout clones and lacZ for twin clones have been effectively employed to quantify growth effects in Drosophila models , providing a methodology for assessing cell-autonomous effects of ZDHHC8 manipulation.

How does ZDHHC8 contribute to epilepsy pathophysiology and potential therapeutic approaches?

ZDHHC8 plays a significant role in epilepsy pathophysiology through its effects on neuronal excitability and synaptic transmission. Studies have revealed increased ZDHHC8 expression in the brains of temporal lobe epilepsy (TLE) patients, mirroring findings in chronic epileptic mouse models . This correlation strongly suggests ZDHHC8 involvement in human epilepsy mechanisms.

In experimental models, ZDHHC8 has demonstrated direct effects on seizure susceptibility:

• In kainic acid- and pilocarpine-induced epileptic mouse models, ZDHHC8 knockdown using recombinant adeno-associated virus (rAAV):

  • Delayed seizure precipitation

  • Decreased chronic spontaneous recurrent seizures (SRSs)

  • Reduced epileptiform-like discharges
    Conversely, ZDHHC8 overexpression exacerbated these parameters .

• At the cellular level, ZDHHC8 modulates neuronal excitability through effects on glutamatergic neurotransmission. In magnesium-free in vitro models, ZDHHC8-knockdown neurons showed reduced hyperexcitability and hypersynchrony, while ZDHHC8-overexpressing neurons exhibited increased excitability .

The underlying molecular mechanism involves ZDHHC8's regulatory effect on α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor trafficking. ZDHHC8 facilitates GluA1 trafficking to the neuronal surface in the hippocampus, affecting the inward rectification of AMPA currents . This suggests a potential therapeutic avenue, where ZDHHC8 inhibition might provide anti-epileptogenic effects by reducing excitatory neurotransmission.

What is the relationship between ZDHHC8 expression and cancer progression?

The relationship between ZDHHC8 expression and cancer progression is complex and appears to be cancer-type dependent. Analysis of The Protein Atlas database has revealed significant correlations between ZDHHC8 expression and patient survival across different cancer types, but with opposing directionality :

• In renal and cervical cancers, high ZDHHC8 expression correlates significantly with shorter survival times, suggesting potential oncogenic functions in these contexts.

• Conversely, in lung and pancreatic cancers, high ZDHHC8 expression correlates significantly with longer survival rates, indicating possible tumor-suppressive roles in these tissues .

This paradoxical relationship suggests that ZDHHC8's function in cancer may be highly context-dependent, possibly due to tissue-specific substrate profiles or interaction with different signaling pathways.

Mechanistically, ZDHHC8's role in growth regulation provides a plausible link to cancer biology. In Drosophila models, ZDHHC8 knockdown results in tissue overgrowth due to increased cell proliferation, suggesting it normally functions to inhibit proliferation . ZDHHC8 palmitoylates key proteins involved in growth control:

• Scribble: A tumor suppressor that regulates cell polarity and Hippo signaling

• Ras64B: A growth regulator involved in proliferation pathways

How might ZDHHC8 dysfunction contribute to developmental disorders?

ZDHHC8 dysfunction has significant implications for developmental processes, as evidenced by its role in Drosophila development and human genomic studies. Several lines of evidence suggest how ZDHHC8 dysfunction might contribute to developmental disorders:

• Developmental lethality: In Drosophila, complete ZDHHC8 knockout is lethal at the larval stage, specifically around the transition from larval stage 2 to 3 . Knockout larvae exhibit:

  • Defects in molting from L2 to L3

  • Failure to grow to normal size

  • Metabolic abnormalities including reduced weight and decreased triglyceride levels

• Neurological implications: ZDHHC8 has been primarily characterized in the brain, where genomic microdeletions encompassing the ZDHHC8 locus at human chromosome 22q11 are associated with cognitive deficits and schizophrenia . This suggests ZDHHC8 plays crucial roles in neurodevelopment.

• Growth regulation: ZDHHC8 appears to regulate tissue growth, with its knockdown causing tissue overgrowth in Drosophila models . This suggests potential roles in maintaining appropriate organ size during development.

• Palmitoylation of developmental regulators: ZDHHC8 palmitoylates proteins involved in developmental processes, including scribble, which regulates cell polarity essential for proper tissue architecture . Disruption of these substrates' palmitoylation could impact developmental patterning and morphogenesis.

The complex phenotypes observed in ZDHHC8-deficient models suggest this enzyme likely influences multiple developmental pathways. Understanding these mechanisms could provide insights into developmental disorders, particularly those involving growth dysregulation or neurological abnormalities.

How do the functions of ZDHHC8 differ across species, and what are the implications for translational research?

ZDHHC8 demonstrates remarkable evolutionary conservation across species while exhibiting some functional differences that warrant consideration in translational research:

• Sequence conservation:

  • Human ZDHHC8 and Drosophila ZDHHC8 (CG34449) show significant sequence homology, with BLASTing human ZDHHC8 against the Drosophila proteome identifying CG34449 as a top hit with an E-value of 10-65 . This high conservation suggests preservation of core enzymatic functions.

  • The DHHC catalytic domain is particularly conserved, reflecting the fundamental importance of the palmitoylation mechanism.

• Functional conservation and divergence:

  • Growth regulation: In both Drosophila and human studies, ZDHHC8 appears to regulate cell proliferation and tissue growth, suggesting conservation of this function .

  • Neurological functions: ZDHHC8 is highly expressed in the brain across species and is implicated in neurological processes in both mice (epilepsy models) and humans (schizophrenia associations) .

  • Substrate specificity may vary between species, with different target proteins potentially palmitoylated by ZDHHC8 in different organisms.

• Implications for translational research:

  • Model selection: When studying ZDHHC8, researchers should carefully consider which model organism best reflects the specific aspect of human ZDHHC8 function relevant to their study.

  • Data interpretation: Phenotypes observed in model organisms should be interpreted with caution, recognizing potential species-specific functions.

  • Validation across models: Important findings should be validated across multiple species when possible to enhance translational relevance.

The conservation of ZDHHC8 across diverse species highlights its fundamental biological importance while requiring careful consideration of species-specific differences when extrapolating findings to human health and disease.

What are the challenges in developing specific inhibitors or modulators of ZDHHC8 activity?

Developing specific inhibitors or modulators of ZDHHC8 presents several significant challenges for researchers:

• Structural complexity and membrane association:

  • ZDHHC8 is a membrane-associated protein with multiple transmembrane domains , making structural studies challenging.

  • Limited high-resolution structural data hampers structure-based drug design approaches.

  • The membrane environment may affect inhibitor accessibility to the catalytic site.

• Selectivity concerns:

  • The DHHC domain is conserved across approximately 23 human DHHC proteins , making selective targeting of ZDHHC8 difficult.

  • Achieving selectivity among palmitoyltransferases requires identifying unique structural features or regulatory mechanisms specific to ZDHHC8.

  • Cross-reactivity with other DHHC family members could lead to off-target effects.

• Context-dependent functions:

  • ZDHHC8 shows tissue- and context-specific functions, with opposing effects in different cancer types .

  • This functional diversity suggests that inhibitors might have contradictory effects depending on the biological context.

  • The complex and sometimes opposing roles of ZDHHC8 in different diseases (e.g., potentially oncogenic in some cancers but tumor-suppressive in others) complicates therapeutic development.

• Validation and assay development:

  • Developing reliable assays for ZDHHC8 activity requires specialized techniques like ABE-MS or ABE-WB .

  • High-throughput screening platforms for palmitoyltransferase inhibitors are not well established.

  • Validating compound specificity requires testing against multiple DHHC family members.

These challenges underscore the need for innovative approaches to develop ZDHHC8-specific modulators, potentially focusing on allosteric sites, unique regulatory mechanisms, or substrate-binding interactions rather than the highly conserved catalytic domain.

How might post-translational modifications of ZDHHC8 itself regulate its activity?

The regulation of ZDHHC8 through its own post-translational modifications represents an intriguing but understudied area of research. While direct evidence from the provided search results is limited, several potential regulatory mechanisms can be inferred from studies of related palmitoyltransferases:

• Auto-palmitoylation:

  • Many DHHC-containing palmitoyltransferases undergo auto-palmitoylation as part of their catalytic cycle.

  • This modification likely occurs within the DHHC motif of ZDHHC8 (as highlighted in the amino acid sequence "...QVRMKWCATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGR" ) and may be essential for its enzymatic activity.

  • Auto-palmitoylation typically forms an acyl-enzyme intermediate that transfers the palmitoyl group to substrate proteins.

• Phosphorylation:

  • ZDHHC8 contains multiple potential phosphorylation sites that could modulate its activity, substrate specificity, or localization.

  • Phosphorylation might regulate ZDHHC8's interaction with substrate proteins or alter its conformation to affect catalytic efficiency.

  • Kinase signaling pathways involved in growth control or neuronal function might regulate ZDHHC8 through phosphorylation, providing a mechanism for context-specific activity regulation.

• Ubiquitination and protein stability:

  • ZDHHC8 levels might be regulated through ubiquitination and subsequent proteasomal degradation.

  • This could explain the varying expression levels observed in different tissues and disease states .

  • Regulation of ZDHHC8 protein stability would provide a mechanism for long-term modulation of its activity.

• Protein-protein interactions:

  • ZDHHC8's activity might be regulated through interactions with scaffold or regulatory proteins.

  • These interactions could be modulated by post-translational modifications of either ZDHHC8 or its interacting partners.

  • Complex formation might affect ZDHHC8's substrate specificity or enzymatic efficiency.

Further research specifically investigating these potential regulatory mechanisms would enhance our understanding of ZDHHC8 biology and potentially reveal new therapeutic approaches targeting its regulation rather than its catalytic activity directly.