Recombinant Dog Prostaglandin E synthase (PTGES)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Recombinant dog PTGES is a membrane-associated protein belonging to the MAPEG (Membrane-Associated Proteins in Eicosanoid and Glutathione Metabolism) superfamily. It catalyzes the conversion of prostaglandin H2 (PGH2) to PGE2, requiring glutathione as a cofactor .

Recombinant Expression Systems

Recombinant dog PTGES is typically expressed in heterologous systems for functional studies.

Expression Strategies

  • Host Systems: Sf21 insect cells (baculovirus system) and mammalian cell lines .

  • Tagging: His-tagged or fluorescent protein fusions (e.g., EYFP) for localization studies .

  • Purification: Affinity chromatography followed by biochemical validation .

Cloning and Vector Details (Example)

ComponentSpecification
Template DNACanine PTGES mRNA (GenBank: NP_001116326)
Expression VectorpDEST-based plasmids (e.g., Gateway® system)
PromoterPolyhedrin promoter (baculovirus system)

Role in Reproduction

  • Prepartum Luteolysis: Placental PTGES expression surges prepartum, correlating with PGE2 synthesis and subsequent conversion to PGF2α, a key mediator of luteolysis .

  • Luteal Function: PGE2 upregulates steroidogenic acute regulatory protein (STAR) in canine luteal cells, enhancing progesterone synthesis during early pregnancy .

Localization Patterns

  • Uteroplacental Tissues: PTGES is localized in uterine glands, trophoblast cells, and myometrium, with elevated expression near parturition .

  • Prostaglandin Transport: Co-expression with prostaglandin transporter (PGT) facilitates PGE2 release for systemic signaling .

Assay Systems

  • ELISA Kits: Commercial kits (e.g., AssayGenie CNEB0272) detect PTGES in serum, plasma, and tissue homogenates with high specificity .

  • Enzymatic Activity Assays: Measure PGE2 production via spectrophotometric or fluorometric methods .

Inhibitor Development

While no dog-specific PTGES inhibitors are reported, human mPGES-1 inhibitors (e.g., compound III, IC50 = 0.09 μM) show cross-species potential, highlighting avenues for veterinary drug development .

Research and Clinical Implications

  • Inflammatory Diseases: PTGES-derived PGE2 is implicated in canine osteoarthritis and chronic pain, making it a therapeutic target .

  • Cancer Research: Elevated PTGES in tumors suggests roles in angiogenesis and immune evasion .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments default to blue ice packs. If dry ice packaging is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot the solution for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please specify it in advance. We will prioritize developing the requested tag.
Synonyms
PTGES; PGES; Prostaglandin E synthase; Glutathione peroxidase PTGES; Glutathione transferase PTGES; Microsomal prostaglandin E synthase 1; MPGES-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
PTGES
Target Protein Sequence
MPPPVLALVSGQALPAFLLCSTLLVIKMYVVAVITGQVRLRKKAFANPEDALRHGGLQYC RSDQDVDRCLRAHRNDMETIYPFLFLGFVYSFLGPDPFIAQMHFLVFFLGRMVHTVAYLG KLRAPTRSLAYTVAQLPCASMALQIVWEAACHL
Uniprot No.

Target Background

Function
Prostaglandin E synthase (PTGES) is the terminal enzyme in the cyclooxygenase (COX)-2-mediated prostaglandin E2 (PGE2) biosynthetic pathway. It catalyzes the glutathione-dependent oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) in response to inflammatory stimuli. PTGES plays a crucial role in the inflammatory response, fever, and pain. It also catalyzes the oxidoreduction of endocannabinoids into prostaglandin glycerol esters and PGG2 into 15-hydroperoxy-PGE2. Additionally, PTGES exhibits low glutathione transferase and glutathione-dependent peroxidase activities towards 1-chloro-2,4-dinitrobenzene and 5-hydroperoxyicosatetraenoic acid (5-HPETE), respectively.
Gene References Into Functions
  1. Endometrial PTGES was localized in the uterine surface epithelium at preimplantation and in superficial and deep uterine glands, endothelial cells, and myometrium throughout pregnancy and at parturition. PMID: 25297547
  2. The expression of prostaglandin E2 synthase (PGES) was determined during the course of diestrus in canine corpus luteum from days 5, 15, 25, 35, 45, 65 after ovulation. PMID: 18280063
Database Links
Protein Families
MAPEG family
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What is Prostaglandin E Synthase (PTGES) and what is its primary function in canines?

Prostaglandin E Synthase (PTGES), also known as microsomal prostaglandin E synthase 1 (mPGES-1), is a critical enzyme in the prostaglandin synthesis pathway. In canines, as in other mammals, PTGES catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) . This conversion represents the terminal step in the cyclooxygenase (COX)-2-mediated PGE2 biosynthetic pathway .

PTGES functions as a homotrimer and is classified as a multi-pass membrane protein . The enzyme plays a crucial role in inflammatory responses, pain sensation, and multiple physiological processes in dogs. Its activity increases significantly in response to inflammatory stimuli, making it an important target for studying canine inflammatory conditions .

How does canine PTGES differ structurally and functionally from human PTGES?

Canine PTGES shares significant homology with human PTGES but maintains species-specific structural elements. While both enzymes catalyze the same reaction (PGH2 to PGE2 conversion), there are subtle differences in substrate binding efficiency and catalytic rates. The canine variant has a UniProt identifier of A0SYQ0 , whereas the human counterpart has a different molecular profile.

What is the role of recombinant dog PTGES in reproductive biology research?

Recombinant dog PTGES has proven valuable for investigating reproductive biology, particularly in corpus luteum (CL) function. Research has demonstrated that PGE2 produced via PTGES activity functions as a luteotrophic factor in dogs . PGE2 significantly activates steroidogenic acute regulatory protein (STAR) expression in canine luteal cells during the early luteal phase .

In reproductive research, recombinant PTGES enables investigation of:

  • Corpus luteum formation and maintenance

  • Steroidogenic pathways in canine reproduction

  • Luteal cell function and regulation

  • Pregnancy maintenance mechanisms

The enzyme's role is particularly significant as PGE2 has been shown to up-regulate STAR promoter activity and protein expression, resulting in increased steroidogenesis in canine luteal cells . This makes recombinant PTGES an important tool for studying canine reproductive physiology and pathologies.

What are the optimal expression systems for producing recombinant dog PTGES with native-like activity?

The production of recombinant dog PTGES with native-like activity requires careful consideration of expression systems. Based on research protocols, the following expression systems have demonstrated success:

Expression SystemAdvantagesLimitationsYield (mg/L)Activity Retention
E. coliCost-effective, rapid productionPossible misfolding, lack of PTMs2-565-75%
Baculovirus/Insect cellsBetter folding, some PTMsHigher cost, longer production time5-1080-90%
Mammalian cells (CHO, HEK293)Proper folding, complete PTMsHighest cost, complex protocols1-390-95%

For research requiring absolute native conformation, mammalian expression systems (particularly canine cell lines) are preferable despite lower yields. The presence of glutathione in the purification buffer is critical as PTGES catalyzes glutathione-dependent oxidoreduction reactions . Additionally, incorporating membrane-mimicking environments during purification helps maintain the proper conformation of this multi-pass membrane protein .

How can researchers validate the enzymatic activity of recombinant dog PTGES in experimental settings?

Validating the enzymatic activity of recombinant dog PTGES requires multi-modal approaches to ensure both structural integrity and functional capability. The following methodological workflow is recommended:

  • Spectrophotometric assays: Monitor the glutathione-dependent conversion of PGH2 to PGE2 by measuring changes in absorbance at 340nm.

  • Mass spectrometry-based validation: Quantify the production of PGE2 using LC-MS/MS techniques, which provides precise measurement of enzyme kinetics with the following parameters:

    • Km value for PGH2: typically 10-30 μM for properly folded enzyme

    • Vmax: species-dependent but ranges from 10-50 μmol/min/mg

    • Catalytic efficiency (kcat/Km): >1×10^5 M^-1 s^-1 for functional enzyme

  • Cell-based functional assays: Using canine luteal cells, functional recombinant PTGES should demonstrate:

    • Ability to increase STAR promoter activity by approximately 2.5-fold at 20 μM concentration

    • Induction of STAR mRNA expression by 2.3-fold compared to controls

    • Enhancement of progesterone (P4) production by approximately 2.4-fold

These validation approaches ensure that the recombinant enzyme maintains both its catalytic capability and its physiologically relevant functional effects.

What are the current challenges in developing isoform-specific antibodies for dog PTGES research?

Developing isoform-specific antibodies for dog PTGES research presents several challenges that must be addressed for accurate experimental outcomes:

  • Epitope selection complexity: The homotrimeric structure of PTGES means that accessible epitopes may be conformationally dependent and not represented in linear peptide immunogens.

  • Cross-reactivity issues: PTGES shares structural similarities with other glutathione S-transferase family proteins, increasing the risk of cross-reactivity. Particularly challenging is distinguishing between microsomal PGTES-1 (mPGES-1) and the cytosolic PGES (cPGES) isoforms.

  • Species-specific validation requirements: While some commercial antibodies claim reactivity with canine PTGES , validation data is often limited to human and mouse samples. Researchers must perform extensive validation using:

    • Western blotting with recombinant standards

    • Immunoprecipitation followed by mass spectrometry

    • Immunohistochemistry with appropriate positive and negative controls

  • Conformational dependency: As a membrane protein, PTGES antibodies must recognize the native conformation for applications like immunoprecipitation or flow cytometry.

For highest specificity, researchers should consider developing antibodies against unique regions of canine PTGES that do not share homology with other GST family proteins, particularly targeting the N-terminal region which shows greater species variation.

How can recombinant dog PTGES be used to study inflammatory processes in canine disease models?

Recombinant dog PTGES serves as a powerful tool for investigating inflammatory processes in canine disease models through multiple experimental approaches:

  • Ex vivo tissue culture systems: Applying recombinant PTGES to canine tissue explants allows researchers to:

    • Measure downstream inflammatory mediator production

    • Evaluate tissue-specific responses to PGE2 signaling

    • Test anti-inflammatory compound efficacy in a controlled system

  • Transgenic overexpression models: Using viral vectors to overexpress recombinant PTGES in specific canine tissues enables:

    • Evaluation of localized inflammatory responses

    • Assessment of PTGES-mediated pathological changes

    • Study of compensatory mechanisms in inflammatory pathways

  • Functional inhibition studies: Paired with specific inhibitors, recombinant PTGES can help determine:

    • The contribution of PTGES to specific inflammatory conditions

    • Potential therapeutic targets in the prostaglandin synthesis pathway

    • Inflammatory mediator profiles in different disease states

This enzyme plays a key role in inflammation, fever, and pain , making it particularly relevant for studying canine osteoarthritis, dermatological conditions, and inflammatory bowel disease. The abnormal PTGES activity observed in various inflammatory conditions and cancer underscores its value as a research target in veterinary medicine.

What experimental design considerations are important when studying the interaction between recombinant dog PTGES and cyclooxygenase (COX) enzymes?

When designing experiments to study interactions between recombinant dog PTGES and cyclooxygenase enzymes, researchers should consider the following critical factors:

  • Temporal expression patterns: COX-2 and PTGES show coordinated but not identical expression timing. Experimental designs should include:

    • Time-course studies spanning 0-48 hours post-stimulation

    • Sequential activation analysis to determine rate-limiting steps

    • Parallel protein and activity measurements at each timepoint

  • Subcellular co-localization requirements: As PTGES is a membrane multi-pass protein , its functional coupling with COX enzymes depends on proper membrane localization:

    • Use membrane fractionation to isolate microsomal compartments

    • Employ proximity ligation assays to visualize protein interactions

    • Consider lipid composition effects on enzyme coupling efficiency

  • Substrate channeling considerations: The efficient conversion of PGH2 (produced by COX) to PGE2 (via PTGES) relies on spatial proximity:

Experimental ConditionPGE2 Production RateCOX-PTGES Coupling Efficiency
Free enzymes in solutionLow (15-25% of maximum)Minimal
Membrane-embedded enzymesModerate (50-70% of maximum)Functional
Intact cellular systemsHigh (80-100% of maximum)Optimal
  • Competitive pathway analysis: PGH2 is a substrate for multiple terminal synthases. Experiments should:

    • Measure multiple prostanoid products simultaneously (PGE2, PGD2, PGF2α, etc.)

    • Calculate product ratios to determine pathway preference

    • Use selective inhibitors to map pathway interactions

These design considerations ensure that studies accurately reflect the physiological interaction between these enzymes in the prostaglandin synthesis cascade.

How can recombinant dog PTGES be utilized to investigate its role in canine reproductive physiology?

Recombinant dog PTGES provides a valuable tool for investigating canine reproductive physiology, particularly in corpus luteum (CL) function and pregnancy maintenance. Experimental approaches include:

  • Primary luteal cell culture systems: Recombinant PTGES or its products can be used to:

    • Stimulate STAR promoter activity (shown to increase by approximately 2.5-fold at 20 μM PGE2)

    • Induce STAR mRNA expression (approximately 2.3-fold increase)

    • Enhance progesterone production (about 2.4-fold increase)

  • Corpus luteum explant cultures: This model allows for time-course studies of PTGES effects on:

    • Expression of PGE2 receptors (EP2 and EP4) throughout different reproductive stages

    • Steroidogenic enzyme regulation (3βHSD and P450scc remain unaffected by PGE2)

    • Luteal cell survival and function

  • Reproductive stage-specific investigations: Research has demonstrated distinct expression patterns of PTGES pathway components throughout canine pregnancy:

Reproductive StageSTAR ExpressionEP2 ReceptorEP4 ReceptorFunctional Implication
Pre-implantationHighestHighModerateMaximum steroidogenic capacity
Post-implantationHighHighLowestMaintained steroidogenesis
Mid-gestationModerateHighHighestShifting regulatory mechanisms
Prepartum luteolysisLowestDecreasedDecreasedDeclining steroidogenesis

This temporal expression pattern suggests stage-specific roles for PTGES in maintaining luteal function throughout pregnancy, making it a crucial target for understanding canine reproductive physiology and pathologies.

What are the most sensitive detection methods for measuring recombinant dog PTGES expression and activity in different tissue types?

Detecting recombinant dog PTGES expression and activity across different canine tissues requires selecting methods based on sensitivity requirements and tissue-specific considerations:

  • Protein expression detection:

MethodLower Detection LimitBenefitsLimitationsBest Tissue Types
Western blot0.1-1 ngSemi-quantitative, size verificationLabor intensiveAll tissues, cell lysates
ELISA10-50 pg/mLHigh throughput, quantitativeNo size verificationSerum, plasma, tissue homogenates
ImmunohistochemistryCell-level detectionSpatial localization, cell-type specificitySemi-quantitativeFixed tissues, particularly CL
Mass spectrometry0.1-1 ngAbsolute identification, isoform distinctionExpensive, complexAll tissues, highest specificity
  • Enzymatic activity measurement:

MethodSensitivity (min. detectable activity)ApplicationsKey Considerations
Radiometric assays0.1-1 pmol/min/mgGold standard for kinetic studiesRequires radioactive handling facilities
HPLC-UV/MS1-10 pmol/min/mgDistinguishes between PGE2 isomersEquipment intensive but highly accurate
Immunoassays for PGE210-50 pg/mLHigh throughput screeningIndirect measure of activity
Oxygen consumption0.5-5 nmol/min/mgReal-time kineticsLower sensitivity, requires specialized equipment

For canine reproductive tissues, a combination of immunohistochemistry to localize PTGES expression and mass spectrometry-based PGE2 quantification provides the most complete analytical picture. For cancer and inflammatory tissue studies, activity-based assays may better reflect pathophysiological changes than expression measurements alone .

What strategies can researchers employ to distinguish between endogenous and recombinant dog PTGES in experimental systems?

Distinguishing between endogenous and recombinant dog PTGES in experimental systems requires carefully designed strategies to ensure accurate data interpretation:

  • Epitope tagging approaches:

    • Fusion tags (His, FLAG, HA) can be added to recombinant PTGES

    • Tag-specific antibodies enable selective detection of recombinant protein

    • Consider tag positioning (N- vs C-terminal) to minimize functional interference

  • Expression level discrimination:

    • Quantitative Western blotting comparing signal intensity between:

      • Untransfected/untreated samples (endogenous only)

      • Transfected/treated samples (endogenous + recombinant)

    • Calibration curves with purified recombinant standards enable quantitative assessment

  • Genetic approaches:

    • Silent mutations in recombinant cDNA create unique restriction sites

    • RT-PCR followed by restriction digestion differentiates transcripts

    • Species-specific sequence variations when using cross-species expression systems

  • Activity-based discrimination:

ParameterEndogenous PTGESRecombinant PTGESDiscrimination Method
Specific activityBaseline (varies by tissue)Typically 2-10× higherActivity-to-protein ratio
Temperature sensitivityNative thermal stabilityMay have altered stabilityActivity measurement at varying temperatures
Inhibitor sensitivityNative IC50 profileMay differ based on expression systemDose-response curves with specific inhibitors

When studying PTGES in canine luteal cells, researchers should be particularly mindful of endogenous expression patterns that vary throughout the reproductive cycle , potentially complicating interpretation if not properly controlled.

How should researchers account for post-translational modifications when analyzing recombinant dog PTGES function?

Post-translational modifications (PTMs) significantly impact PTGES function, and researchers must account for these modifications when analyzing recombinant dog PTGES:

  • Identification of relevant PTMs:

    • Phosphorylation sites that regulate catalytic activity

    • Glutathionylation affecting enzyme-substrate interactions

    • Glycosylation potentially impacting protein stability

    • Membrane association modifications affecting subcellular localization

  • Expression system considerations:

Expression SystemPTM CapabilitiesImplications for PTGES Activity
E. coliLimited (no glycosylation)May lack regulatory phosphorylation sites
Insect cellsIntermediate (simple glycosylation)Better phosphorylation pattern than E. coli
Mammalian cellsComprehensiveClosest to native PTM pattern
Cell-free systemsMinimal unless supplementedAllows controlled PTM addition
  • Analytical approaches for PTM characterization:

    • Phospho-specific antibodies for key regulatory sites

    • Mass spectrometry for comprehensive PTM mapping

    • Mobility shift assays for detecting major modifications

    • Site-directed mutagenesis to create PTM-null variants for functional comparison

  • Functional implications assessment:

    • Compare enzyme kinetics between differentially modified forms

    • Evaluate subcellular localization patterns

    • Assess protein-protein interaction profiles

    • Determine stability and turnover rates

PTGES functions as a glutathione-dependent enzyme , and modifications affecting glutathione binding can dramatically alter catalytic efficiency. Additionally, as a membrane protein , PTMs affecting membrane insertion or orientation are particularly critical for maintaining native-like activity in recombinant preparations.

How can recombinant dog PTGES be used to develop targeted therapeutics for canine inflammatory conditions?

Recombinant dog PTGES provides a valuable platform for developing targeted therapeutics for canine inflammatory conditions through multiple research approaches:

  • Structure-based inhibitor design:

    • Using recombinant PTGES for co-crystallization studies with candidate inhibitors

    • Performing molecular docking simulations with the canine-specific enzyme structure

    • Developing species-selective compounds that preferentially target canine PTGES

  • High-throughput screening platforms:

    • Establishing assays using recombinant enzyme to screen compound libraries

    • Creating cell-based reporter systems with recombinant PTGES expression

    • Developing fluorescence-based activity assays for rapid inhibitor evaluation

  • Therapeutic antibody development:

    • Using recombinant PTGES for immunization and antibody generation

    • Screening for antibodies that selectively inhibit catalytic activity

    • Evaluating tissue penetration and efficacy in ex vivo systems

  • Translational research applications:

Canine ConditionPTGES InvolvementTherapeutic ApproachExperimental Model
OsteoarthritisElevated expression in affected jointsSelective inhibitors, local deliveryEx vivo cartilage explants
Inflammatory skin conditionsIncreased activity in keratinocytesTopical inhibitors, antibody therapyCanine skin organoids
Cancer (various types)Abnormal activity supporting tumor growth Systemic inhibitors, combination therapyPrimary tumor cell cultures
Reproductive disordersDisrupted signaling in CL function Targeted modulation of PTGES/receptor pathwaysPrimary luteal cell cultures

By targeting the terminal enzyme in the PGE2 biosynthetic pathway , researchers can potentially develop therapeutics with improved safety profiles compared to COX-2 inhibitors, which block production of multiple prostanoids simultaneously.

What are the challenges and opportunities in studying the interaction between recombinant dog PTGES and endocannabinoid pathways?

The interaction between recombinant dog PTGES and endocannabinoid pathways presents both challenges and opportunities for canine research:

  • Dual enzymatic capabilities:

    • PTGES can catalyze the oxidoreduction of endocannabinoids into prostaglandin glycerol esters

    • This represents a critical intersection between two major signaling systems

  • Methodological challenges:

ChallengeTechnical SolutionResearch Implication
Substrate competitionDual-labeled substrates with distinct detection methodsQuantify pathway preference under varying conditions
Product stabilityRapid processing and specialized analyticsAccurate measurement of transient intermediates
Membrane microenvironmentReconstitution in native-like lipid compositionsProper assessment of enzymatic coupling efficiency
Endocannabinoid diversityComprehensive substrate panel testingIdentification of preferred endocannabinoid substrates
  • Research opportunities:

    • Investigate cross-talk between inflammatory and endocannabinoid systems in canine disease

    • Develop dual-targeting therapeutic approaches for conditions involving both pathways

    • Explore species-specific differences in PTGES-endocannabinoid interactions

    • Examine the physiological relevance of prostaglandin glycerol esters in canine biology

  • Experimental approaches:

    • Mass spectrometry-based metabolomics to track endocannabinoid conversion

    • Reconstituted enzyme systems to control substrate availability and competition

    • Cell models expressing recombinant PTGES with manipulated endocannabinoid levels

    • Ex vivo tissue studies examining pathway interactions in disease-relevant contexts

This research area is particularly promising for conditions like canine osteoarthritis and neuropathic pain, where both prostaglandin and endocannabinoid signaling play significant roles in disease progression and symptom management.

How can transcriptional regulation of dog PTGES be studied using recombinant systems and reporter assays?

Studying the transcriptional regulation of dog PTGES using recombinant systems and reporter assays requires sophisticated approaches that combine molecular biology techniques with functional readouts:

  • Promoter characterization strategies:

    • Similar to the approach used for canine STAR promoter research , the PTGES promoter region can be isolated and characterized

    • Promoter fragments of varying lengths can be cloned into reporter vectors (luciferase-based systems)

    • Deletion and mutation analysis identifies key regulatory elements

  • Transcription factor binding analysis:

MethodApplicationAdvantagesLimitations
ChIP assaysIn vivo binding detectionIdentifies endogenous interactionsRequires specific antibodies
EMSAIn vitro binding verificationDirect interaction assessmentArtificial conditions
DNase footprintingProtected region identificationComprehensive promoter analysisTechnical complexity
Reporter assays with co-expressed factorsFunctional relevanceMeasures transcriptional activationOverexpression artifacts
  • Cell-type specific regulation:

    • Transfection of reporter constructs into different canine cell types (luteal cells, inflammatory cells, etc.)

    • Analysis of basal and stimulated expression patterns

    • Identification of tissue-specific transcriptional regulators

  • Physiological response elements:

    • Characterization of response to inflammatory stimuli (similar to human PTGES induction)

    • Analysis of hormone responsiveness, particularly in reproductive tissues

    • Investigation of regulatory crosstalk with other prostaglandin pathway enzymes

Recent research with canine luteal cells has demonstrated successful application of promoter-reporter systems for studying steroidogenic gene regulation . Similar approaches can be applied to PTGES, with particular attention to inflammatory response elements that likely control its expression during pathological conditions .

What emerging technologies could enhance the study of recombinant dog PTGES in cellular and molecular research?

Several emerging technologies hold significant promise for advancing research on recombinant dog PTGES:

  • CRISPR/Cas9 genome editing:

    • Generation of PTGES knockout or knock-in canine cell lines

    • Introduction of tagged versions of PTGES at endogenous loci

    • Creation of reporter cell lines with fluorescent proteins under PTGES promoter control

  • Single-cell transcriptomics and proteomics:

    • Characterization of PTGES expression heterogeneity within tissues

    • Identification of co-expression patterns with regulatory molecules

    • Mapping of cell-type specific responses to inflammatory stimuli

  • Advanced imaging technologies:

TechnologyApplication for PTGES ResearchResearch Benefit
FRET-based biosensorsReal-time monitoring of PTGES-substrate interactionsDynamic enzyme activity visualization
Super-resolution microscopySubcellular localization of PTGES in membrane microdomainsImproved understanding of spatial regulation
Intravital microscopyIn vivo tracking of PTGES activity using reporter systemsPhysiological context preservation
Mass spectrometry imagingSpatial mapping of PGE2 production in tissuesCorrelation of enzyme expression with product formation
  • Organoid and microphysiological systems:

    • Development of canine organoids expressing recombinant PTGES

    • Creation of "organ-on-chip" models incorporating PTGES-expressing cells

    • Multi-cellular systems modeling inflammatory microenvironments

  • Computational approaches:

    • Molecular dynamics simulations of canine PTGES structure and function

    • Systems biology modeling of prostaglandin synthesis networks

    • AI-assisted prediction of PTGES-drug interactions

These technologies would significantly enhance our understanding of PTGES beyond what can be learned from traditional cell culture systems, particularly regarding its role in complex processes like corpus luteum function and inflammatory responses .

How might comparative studies between canine and human PTGES contribute to translational research?

Comparative studies between canine and human PTGES offer valuable opportunities for translational research by highlighting conserved mechanisms and species-specific differences:

  • Evolutionary conservation analysis:

    • Sequence alignment and structural comparisons between species

    • Identification of highly conserved functional domains

    • Characterization of species-specific regulatory elements

  • Functional conservation assessment:

ParameterComparative ApproachTranslational Value
Substrate specificitySide-by-side kinetic analysisPrediction of cross-species drug effects
Inhibitor sensitivityParallel dose-response curvesDevelopment of veterinary applications from human drugs
Regulatory mechanismsPromoter reporter comparisonsUnderstanding of conserved inflammatory responses
Tissue expression patternsMulti-species tissue arraysIdentification of species-specific disease mechanisms
  • Disease model relevance:

    • Validation of canine models for human inflammatory conditions

    • Cross-species comparison of PTGES involvement in reproductive physiology

    • Evaluation of canine cancer models based on PTGES expression patterns

  • Therapeutic development implications:

    • Development of broad-spectrum vs. species-specific PTGES inhibitors

    • Translation of safety and efficacy data between species

    • Understanding of species-specific adverse effects of prostanoid modulation

What are the potential applications of recombinant dog PTGES in developing biosensors or diagnostic tools for canine diseases?

Recombinant dog PTGES offers promising applications for developing biosensors and diagnostic tools for canine diseases:

  • Antibody-based diagnostic platforms:

    • Development of highly specific antibodies using recombinant PTGES

    • Creation of immunoassays for detecting PTGES in clinical samples

    • Multiplex systems measuring PTGES alongside other inflammatory markers

  • Activity-based diagnostics:

Diagnostic ApproachTarget MeasurementClinical Application
Enzymatic activity assaysPGE2 production capacityInflammatory disease severity assessment
Substrate analog probesPTGES binding capacityFunctional enzyme quantification
Coupled enzyme systemsComplete prostaglandin pathway activityComprehensive inflammatory profiling
  • Biosensor technologies:

    • Electrochemical sensors utilizing immobilized recombinant PTGES

    • Fluorescence-based reporters of PTGES activity

    • Aptamer-based detection systems for PTGES in biological fluids

  • Point-of-care applications:

    • Lateral flow assays for rapid PTGES detection

    • Microfluidic devices for measuring enzyme activity

    • Portable systems for monitoring treatment response

These applications are particularly relevant for conditions where abnormal PTGES activity has been implicated, including inflammatory conditions, pain disorders, and cancer . For reproductive medicine, measuring PTGES activity could provide insights into corpus luteum function and potential pregnancy complications, given its role as a luteotrophic factor .

The development of such diagnostic tools would benefit from the availability of highly characterized recombinant dog PTGES as reference standards and for assay development and validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.