Recombinant Dog Prostaglandin E2 receptor EP2 subtype (PTGER2)

Shipped with Ice Packs
In Stock

Description

Mechanistic Insights and Signaling Pathways

The recombinant dog PTGER2 mimics endogenous EP2 receptor function, enabling studies on PGE2 signaling in canine models. Key pathways include:

Gs Protein-Coupled cAMP Signaling

  • Primary Pathway: PGE2 binding activates Gs, increasing cAMP and PKA activity. This cascade regulates:

    • Smooth muscle relaxation (e.g., airway, vascular)

    • Immune cell modulation (e.g., T-cell responses, dendritic cell function)

    • Neuroprotection in acute brain injury models

Non-Canonical Pathways

  • β-Catenin/Wnt Signaling: EP2 activation promotes β-catenin nuclear translocation, enhancing cell proliferation and migration .

  • GSK-3 Pathway: Modulates innate immune responses and cytokine production (e.g., IL-1β, IL-6) .

PathwayBiological OutcomeRelevance to Disease
cAMP/PKASmooth muscle relaxation, immune suppressionAsthma, inflammatory disorders
β-Catenin/WntTumor cell proliferation, metastasisCancer progression
GSK-3Inflammatory cytokine regulationAutoimmune diseases, fibrosis

Disease Modeling and Therapeutic Development

  • Cancer Research:

    • EP2 promotes tumor growth via IL-1β/IL-6 upregulation and β-catenin pathway activation .

    • Antagonists like TG4-155 inhibit metastasis in prostate cancer models .

  • Inflammatory Disorders:

    • Asthma/Chronic Rhinosinusitis: Reduced PTGER2 expression linked to aspirin-exacerbated respiratory disease (AERD) due to promoter hypermethylation .

    • Pulmonary Fibrosis: Downregulated EP2 in idiopathic pulmonary fibrosis (IPF) correlates with disease severity .

Comparative Analysis with Orthologs

The dog PTGER2 shares high sequence homology with mammalian orthologs, facilitating cross-species insights:

SpeciesUniProt IDSequence IdentityKey Functional Similarity
HumanP4311688%Gs-coupled cAMP signaling, no desensitization
MouseQ6205383%Cancer cell invasion, inflammatory cytokine regulation
RatQ6292880%Neuroprotective effects in brain injury models

Limitations and Future Directions

  • Dog-Specific Data Gaps: Limited studies directly on canine PTGER2; most insights derive from human/mouse models.

  • Therapeutic Potential:

    • Cancer: EP2 antagonists may reduce tumor progression in dogs with osteosarcoma or lymphoma.

    • Neurodegeneration: EP2’s neuroprotective role warrants investigation in canine aging models.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your preparations.
Shelf Life
The shelf life of our proteins is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
PTGER2; Prostaglandin E2 receptor EP2 subtype; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; Prostanoid EP2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MGSISNNSGSEDCESREWLPSGESPAISSAMFSAGVLGNLIALALLARRWRGDAGRRAGR GNSISLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLMALEPERRACTYFAFAMTFFS LATMLMLFAMALERYLSIGRPYFYQRHVTRRGGLAVLPTIYTVSLLFCSLPLLGYGQYVQ YCPGTWCFIRHGRTAYLQLYATLLLLLIVAVLACNFSVILNLIRMHRRSGRSRCGPSLGS CRDGSGTRRRGERVSVAEETDHLILLAIMTITFAICSLPFTIFAYMNETSSRREKWDLQA LRFLSINSIIDPWVFAIFRPPVLRLMRSVLCCRVSLRAQDATQTSCSIQSNASRLTFVDT S
Uniprot No.

Target Background

Function
Prostaglandin E2 receptor EP2 subtype (PTGER2) is a receptor for prostaglandin E2 (PGE2). Its activity is mediated by G(s) proteins that stimulate adenylate cyclase. The resulting increase in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle.
Gene References Into Functions
  1. In situ hybridization studies have shown co-localization of EP2 and EP4 in the cytoplasm of luteal cells during diestrus. PMID: 18280063
  2. PGE2 potentiates tonicity-induced COX-2 expression in renal medullary cells through a positive feedback loop involving EP2-cAMP-PKA signaling. PMID: 19005164
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and characterization of canine PTGER2?

Canine Prostaglandin E2 receptor EP2 subtype (PTGER2) is a G protein-coupled receptor belonging to the rhodopsin-like receptor family. The protein is encoded by the PTGER2 gene located on the canine genome. It contains 358 amino acids with seven transmembrane domains and functions as a receptor for prostaglandin E2 (PGE2) .

Structurally, dog PTGER2 shares significant sequence homology with orthologs from other species:

SpeciesProtein AccessionQuery CoverageE-valueIdentity (%)
HumanP4311699088
MouseQ6205398083
RatQ6292898080

These data demonstrate the high conservation of PTGER2 across mammalian species, which supports translational research from canine models to human applications .

What signaling pathways are activated by canine PTGER2?

Canine PTGER2 primarily signals through G(s) proteins that stimulate adenylate cyclase, leading to increased intracellular cAMP levels. This elevation in cAMP is responsible for the relaxing effect of this receptor on smooth muscle tissue . The signaling cascade initiated by PTGER2 activation involves:

  • Binding of PGE2 to the receptor

  • Activation of G(s) proteins

  • Stimulation of adenylate cyclase

  • Increased production of cAMP

  • Activation of downstream effectors including protein kinase A (PKA)

This cAMP/PKA pathway is central to the physiological functions of PTGER2 and forms the basis for many research applications targeting this receptor .

How can I validate the expression of PTGER2 in canine tissue samples?

For reliable validation of PTGER2 expression in canine tissues, a multi-method approach is recommended:

  • RT-qPCR: Design primers specific to the canine PTGER2 gene (NP_001003170.1 reference sequence) for mRNA quantification.

  • Western blotting: Use antibodies that cross-react with canine PTGER2 based on the high sequence homology with human PTGER2 (88% identity) .

  • Immunohistochemistry: This method can localize PTGER2 expression in tissue sections, as demonstrated in studies examining canine transitional cell carcinoma, where 11 out of 15 samples showed positive staining .

  • Functional assays: Measure cAMP levels in response to PGE2 stimulation to confirm the presence of functional receptors.

When reporting expression data, clearly distinguish between mRNA detection (PTGER2 gene expression) and protein detection (EP2 receptor presence) to avoid misinterpretation of results .

How does PTGER2 expression differ between normal and pathological canine tissues?

Research has revealed significant variation in PTGER2 expression across normal and pathological canine tissues. In canine transitional cell carcinoma (TCC), PTGER2 was found to be the most upregulated gene when comparing TCC tissues with normal bladder tissues. Specifically, EP2 protein expression was detected in tumor cells in 11 out of 15 canine TCC tissue samples, while being absent in normal epithelial cells .

This differential expression pattern mirrors findings in human urothelial cancer, where EP2 expression is significantly upregulated compared to normal urothelium, although some contradictory findings have been reported showing decreased EP2 expression in certain bladder cancer tissues . These contradictions highlight the importance of:

  • Using consistent methodologies for expression analysis

  • Considering tissue heterogeneity and cancer subtypes

  • Evaluating both transcriptional and translational regulation

  • Assessing subcellular localization of the receptor

The consistent upregulation of PTGER2 in both human and canine TCC makes it a promising therapeutic target, though targeting strategies are still being investigated .

What experimental approaches can be used to selectively activate or inhibit canine PTGER2?

Selective manipulation of canine PTGER2 requires precise pharmacological or genetic tools:

Activation strategies:

  • Selective agonists: Compounds like CP-533,536, a pyridyl sulfonamide derivative, have been developed as selective EP2 receptor agonists. This compound has been tested in canine models for bone healing applications, demonstrating efficacy in critical bone defects and osteotomies .

  • Recombinant PGE2: While less selective, appropriate dosing of PGE2 can preferentially activate EP2 receptors, particularly in systems with high EP2 expression.

Inhibition strategies:

  • Receptor antagonists: Selective EP2 receptor antagonists can be used to block receptor function without affecting other prostanoid receptors.

  • Genetic approaches: siRNA targeting PTGER2 can be used for transient knockdown, as demonstrated in studies with RORC-specific siRNA that affected EP2 expression .

  • CRISPR-Cas9: For permanent genetic modification, CRISPR-Cas9 targeting of the canine PTGER2 gene can generate knockout cell lines.

When designing experiments with these tools, researchers should consider:

  • Receptor selectivity profiles of pharmacological agents

  • Potential compensatory mechanisms between PGE2 receptors

  • Species-specific differences in drug responses

  • Appropriate controls to validate target engagement

How is canine PTGER2 involved in reproductive biology and decidualization?

Canine PTGER2 plays a crucial role in reproductive processes, particularly during decidualization – the transformation of endometrial stromal cells in preparation for pregnancy. Research using dog uterine stromal (DUS) cells has revealed:

  • PGE2-PTGER2/4 signaling axis: Both PTGER2 and PTGER4 mediate the effects of PGE2 during canine decidualization. Functional inhibition of these receptors suppresses the expression of key decidualization markers like PRLR (prolactin receptor) and PGR (progesterone receptor) .

  • Hormone interactions: A reciprocal regulatory loop exists between PGE2 and progesterone during canine in vitro decidualization:

    • Progesterone increases PTGER2 levels in the presence of PGE2

    • PGE2 regulates PGR levels in a manner dependent on PTGER2 and PTGER4

  • Extracellular matrix modification: Although PGE2 is involved in decidualization, it does not appear to regulate extracellular matrix components like COL4, ECM1, and CX43, which are instead controlled by cAMP. This suggests differential roles for different components of the PGE2-PTGER2 signaling pathway .

These findings highlight the potential of targeting PTGER2 in reproductive research and potential therapeutic applications for canine reproductive disorders. The similarities between canine and human early decidualization processes further emphasize the translational value of these studies .

What is the role of PTGER2 in canine oncology research?

PTGER2 has emerged as a significant factor in canine oncology research, particularly in the context of transitional cell carcinoma (TCC):

  • Differential expression: PTGER2 is the most upregulated gene in canine TCC samples compared to normal bladder tissue. Protein-level validation confirmed EP2 expression in tumor cells of 11/15 canine TCC tissues, while normal epithelial cells lacked EP2 expression .

  • Comparative oncology: The overexpression of EP2 in both human and canine TCC establishes PTGER2 as a promising comparative oncology target. This parallel expression pattern supports the use of canine models for translational research on targeting the PGE2-EP2 axis in bladder cancer .

  • Tumor promotion: Research suggests that the PTGER2 receptor can act as a tumor promoter, though the exact mechanisms in canine cancer are still being elucidated .

  • Therapeutic targeting potential: While the overexpression of PTGER2 in canine TCC makes it a promising target, the efficacy of specific targeting agents requires further investigation .

For researchers designing studies targeting PTGER2 in canine cancer models, considerations should include:

  • Heterogeneity of PTGER2 expression within tumor samples

  • Potential for compensatory mechanisms through other PGE2 receptors

  • Development of selective compounds with appropriate pharmacokinetic properties for in vivo studies

  • Validation of target engagement in canine tissues

How can canine PTGER2 research inform translational studies for human applications?

Canine PTGER2 research offers valuable insights for human applications due to the high sequence homology (88% identity) and functional conservation between species . Key translational aspects include:

  • Comparative medicine: Most canine cancers with PTGER2 involvement are often compared to adult human cancers, providing natural disease models that better recapitulate human conditions than induced laboratory animal models .

  • Therapeutic development: The EP2 receptor-selective agonist CP-533,536 has been tested in canine models for bone healing, successfully inducing bone repair without the side effects associated with PGE2. These findings have potential applications for human bone healing therapies .

  • Receptor regulation mechanisms: Studies on the transcriptional regulation of PTGER2 by factors like RORC reveal conserved mechanisms that can inform human immune cell research, particularly in the context of autoimmune diseases where PTGER2 expression is altered .

  • Methodology transfer: Experimental protocols developed for studying canine PTGER2, including receptor binding assays, signaling pathway analysis, and functional assessment, can be adapted for human studies with minor modifications, accelerating translational research .

When designing translational studies, researchers should account for:

  • Species-specific differences in pharmacokinetics and pharmacodynamics

  • Regulatory pathways that may differ between canines and humans

  • Disease progressions that may have species-specific characteristics

  • Ethical considerations in companion animal research

What are the optimal conditions for expressing and purifying recombinant canine PTGER2?

Producing high-quality recombinant canine PTGER2 requires careful optimization of expression and purification protocols:

Expression systems:

  • Mammalian cell expression: HEK293 or CHO cells are preferred for maintaining proper folding and post-translational modifications of canine PTGER2. These systems have been successfully used for expressing prostanoid receptors for binding assays .

  • Insect cell expression: Baculovirus-infected Sf9 or Hi5 cells can produce higher yields while maintaining most post-translational modifications.

Expression optimization:

  • Use the canine PTGER2 sequence (UniProt ID: Q9XT82)

  • Consider adding affinity tags (His, FLAG) for purification, preferably at the C-terminus to avoid interfering with ligand binding

  • Optimize codon usage for the chosen expression system

  • Include stabilizing mutations or fusion partners if expression levels are low

Purification approach:

  • Solubilize membrane fractions using appropriate detergents (DDM, LMNG)

  • Use affinity chromatography as the initial purification step

  • Follow with size exclusion chromatography to separate monomeric receptor from aggregates

  • Confirm purity by SDS-PAGE and functionality by ligand binding assays

For functional studies of the purified receptor, reconstitution into nanodiscs or liposomes may be required to maintain the native-like membrane environment .

What are the challenges in developing selective ligands for canine PTGER2?

Developing selective ligands for canine PTGER2 presents several challenges that researchers should consider:

  • Receptor homology: The high sequence similarity between EP receptor subtypes (EP1, EP2, EP3, EP4) complicates the design of truly selective compounds. Researchers must carefully validate selectivity against all EP receptor subtypes .

  • Species differences: Despite 88% sequence identity between human and canine PTGER2, subtle differences in the binding pocket can affect ligand affinity and selectivity. Compounds optimized for human EP2 may require modification for optimal binding to canine PTGER2 .

  • Functional assessment: Screening compounds requires multiple assays to confirm:

    • Binding specificity (competitive binding assays)

    • Functional activity (cAMP accumulation assays)

    • Off-target effects (screening against related GPCRs)

  • Pharmacokinetic properties: Developing in vivo tools requires optimization of:

    • Metabolic stability in canine microsomes

    • Plasma protein binding

    • Blood-brain barrier penetration (for CNS studies)

    • Oral bioavailability (if relevant)

The development of CP-533,536, a selective EP2 agonist tested in canine models, exemplifies a successful approach. This compound was identified through screening for selective EP2 binding followed by functional characterization of cAMP elevation, demonstrating the viability of this development pipeline .

How can researchers address conflicting data on PTGER2 expression in disease models?

Conflicting reports on PTGER2 expression in disease models present a methodological challenge. For instance, in bladder cancer, some studies report upregulation while others show decreased expression in cancer tissues compared to normal tissues . To address such discrepancies:

  • Standardize detection methods:

    • Use multiple techniques (qPCR, Western blot, IHC)

    • Apply consistent antibody validation protocols

    • Quantify expression using standardized scoring systems

  • Account for subcellular localization:

    • Distinguish between cytoplasmic, nuclear, and membrane expression

    • Consider that functioning of PTGER2 depends on its correct localization

  • Consider tissue heterogeneity:

    • Use microdissection to separate tumor from stroma

    • Analyze multiple regions within the same sample

    • Account for tumor grade and stage when comparing samples

  • Validate with functional data:

    • Correlate expression with downstream signaling markers (cAMP levels)

    • Confirm receptor functionality using selective agonists

    • Assess the effects of receptor inhibition on disease phenotypes

  • Meta-analysis approach:

    • When possible, perform meta-analyses of multiple studies

    • Weight studies based on methodological quality

    • Identify variables that might explain inconsistent results

How can novel PTGER2 modulators be evaluated in canine disease models?

Evaluation of novel PTGER2 modulators in canine disease models requires a systematic approach spanning from in vitro characterization to in vivo efficacy studies:

In vitro characterization:

  • Receptor binding assays: Determine binding affinity (Kd) and selectivity using membranes from cells stably transfected with canine PTGER2 .

  • Functional assays: Measure cAMP production using methods like ELISA or reporter gene assays to determine EC50/IC50 values.

  • Selectivity profiling: Test compounds against other prostanoid receptors and related GPCRs to ensure specificity.

Ex vivo assessment:

  • Tissue explants: Test compound effects on relevant canine tissues expressing native levels of PTGER2.

  • Organoid models: Use canine-derived organoids to evaluate responses in 3D tissue-like environments.

In vivo evaluation:

  • PK/PD studies: Determine the pharmacokinetic profile in dogs and establish exposure-response relationships.

  • Target engagement: Develop biomarkers to confirm target modulation (e.g., plasma or tissue cAMP levels).

  • Efficacy models: Select appropriate disease models based on PTGER2 involvement:

    • Bone healing models (e.g., critical defect of the canine ulna or tibial osteotomy)

    • Canine transitional cell carcinoma models

    • Inflammatory models

Analytical methods:
For pharmacokinetic studies of PTGER2 modulators, liquid chromatography-tandem mass spectrometry (LC-MS/MS) has been successfully employed. For instance, when studying CP-533,536, researchers used LC-MS/MS with negative ion mode and multireaction monitoring, achieving a linear dynamic range from 1 to 2,000 ng/ml with 80-116% accuracy .

What are the emerging roles of PTGER2 in canine immunology and inflammatory conditions?

Recent research has illuminated complex roles for PTGER2 in canine immunology and inflammatory responses, with important implications for therapeutic development:

These emerging roles suggest that targeting PTGER2 could have therapeutic potential for canine inflammatory and immune-mediated conditions, though careful consideration of its complex effects is necessary .

How does the structure-function relationship of canine PTGER2 inform drug design strategies?

Understanding the structure-function relationship of canine PTGER2 provides crucial insights for rational drug design:

  • Key structural features:

    • Canine PTGER2 contains seven transmembrane domains characteristic of G protein-coupled receptors

    • The receptor consists of 358 amino acids with extracellular N-terminus and intracellular C-terminus

    • The protein sequence is highly conserved between humans (88% identity) and other mammals

  • Binding pocket analysis:

    • Although a crystal structure for canine PTGER2 is not yet available, homology modeling based on related GPCRs can predict the binding pocket architecture

    • Key residues for ligand binding can be inferred from studies with human EP2 receptor and validated through mutagenesis

    • Differences in the few non-conserved residues between human and canine PTGER2 may explain species-specific pharmacology

  • Signaling determinants:

    • The intracellular loops and C-terminal domain are critical for G-protein coupling and subsequent cAMP signaling

    • Understanding the conformational changes that occur upon agonist binding can guide the design of biased ligands that selectively activate certain signaling pathways

  • Drug design strategies:

    • Structure-based design: Using homology models to identify key interaction points within the binding pocket

    • Fragment-based approaches: Building molecules that target specific sub-pockets within the binding site

    • Allosteric modulators: Designing compounds that bind outside the orthosteric site to modulate receptor function

    • Peptide-based inhibitors: Developing peptides that interfere with protein-protein interactions in the signaling complex

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.