Recombinant Dog Protein CLN8 (CLN8)

Shipped with Ice Packs
In Stock

Description

CLN8 Protein Overview

The CLN8 gene encodes a transmembrane protein localized primarily to the endoplasmic reticulum (ER) and ER-Golgi intermediate compartment (ERGIC) . Its precise biochemical function remains unclear, but it is implicated in lipid metabolism and intracellular transport . Mutations in CLN8 lead to neurodegenerative NCL disorders characterized by lysosomal storage of autofluorescent lipopigments, seizures, and premature death in humans and dogs .

Pathogenic CLN8 Mutations in Canine Models

Canine NCL models with CLN8 mutations are critical for studying disease mechanisms and therapies:

  • *c.585G>A (p.Trp195)**: A nonsense mutation identified in mixed-breed dogs (Australian Shepherd/Blue Heeler ancestry) causes late-infantile NCL with neurological decline, retinal degeneration, and death by ~21 months .

  • 37:30895648G>A: A termination codon in German Shorthaired Pointers induces NCL with ataxia, vision loss, and cognitive decline .

Key Pathological Features in Affected Dogs:

FeatureDescriptionSource
Autofluorescent storageLysosomal accumulation in neurons (cerebrum, cerebellum, retina)
UltrastructureMembranous whorls and granular osmophilic deposits
LifespanReduced to 8–21 months (untreated)

Therapeutic Approaches Targeting CLN8

While no recombinant CLN8 protein therapies are documented, gene therapy using adeno-associated virus (AAV) vectors has shown efficacy:

AAV9-CLN8 Gene Therapy in Mice:

  • Treatment: Intracerebroventricular delivery of scAAV9.pT-MecP2.CLN8.

  • Outcomes:

    • Lifespan: Extended from 10 months (untreated) to >24 months .

    • Histopathology: Reduced autofluorescent storage material (ASM) and mitochondrial SubC accumulation in brain regions .

    • Behavior: Improved motor function and learning/memory tasks .

Recombinant Protein Therapies for Canine NCL

Though not specific to CLN8, recombinant enzyme therapies for other NCL subtypes highlight translational strategies:

Examples in Dachshund CLN2 Models:

TherapyMechanismOutcomeSource
Recombinant human TPP1 (rhTPP1)Enzyme replacement via CSF infusionDelayed symptom onset, extended lifespan
AAV-TPP1 gene therapyOne-time intracerebroventricular injectionSustained enzyme activity, reduced neurodegeneration

Research Gaps and Opportunities

  • Recombinant CLN8 Protein: Current literature lacks evidence of recombinant CLN8 protein development. Challenges include the protein’s transmembrane structure and ER retention signals (e.g., KKRP motif) complicating soluble expression .

  • Alternative Strategies: Gene therapy remains the primary focus, with AAV9 demonstrating durable CLN8 expression in murine models .

Confounding Factor: IL-8/CXCL8 Recombinant Protein

Search results reference Recombinant Canine IL-8/CXCL8 (unrelated to CLN8), a proinflammatory chemokine used in immunology research. This protein is distinct from CLN8 and should not be conflated .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preferences when placing your order and we will fulfill them to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for precise delivery estimates.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please let us know, and we will prioritize development of the specified tag.
Synonyms
CLN8; Protein CLN8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
CLN8
Target Protein Sequence
MTPMSDGGTSESIFDLDYTSWKIRSTLAVAGFVFYLGVFVVCHQLSSSLNATYRSLVARE KVFWNLAATRAVFGVQSTAAGLWALLVDPVLHADKARGQQNWCWFHIATATGFFFFENVA VHLSNVLFRTFDLFLAIHHLFAFLGFLGSVVNLGAGHYLAMSTLLLEASTPFTCISWMLL KAGWSESLFWKLNQWLMIHMFHCRMVLTYHMWWVCFWHWDGLVSSLYLPHLALFLVGLGL LTLVINPYWTHKKTQQLLNPVDWNFAQPAPRSSRPAGANGQVPQKKGQ
Uniprot No.

Target Background

Function
CLN8 is believed to play a role in cell proliferation during neuronal differentiation and may contribute to protecting against cell death.
Gene References Into Functions
  1. The CLN8 T-to-C transition is considered a likely cause of English Setter neuronal ceroid-lipofuscinosis. PMID: 15629147
Database Links
Involvement In Disease
Defects in CLN8 are a cause of a form of neuronal ceroid lipofuscinosis (NCL) in English setters.
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Q&A

What is CLN8 and what is its primary biochemical function?

CLN8 is a member of the TLCD (TRAM-LAG1-CLN8 domain) family of proteins, which contains 16 members in the human genome. Recent research has revealed that CLN8 functions as a lysophosphatidylglycerol acyltransferase involved in the biosynthesis of bis(monoacylglycero)phosphate (BMP), a key phospholipid found in lysosomes . The protein is encoded by the CLN8 gene, mutations in which cause a form of neuronal ceroid lipofuscinosis (NCL), also known as Batten disease . Functionally, CLN8 catalyzes the acylation of R,S-lysophosphatidylglycerol (LPG) in the endoplasmic reticulum/Golgi to produce R,S-BMP intermediate, which is a crucial step in the BMP synthesis pathway .

What is the structural organization of CLN8 protein?

The CLN8 protein (UniProt ID: Q9UBY8 for human, Q5JZQ7 for dog) consists of 286 amino acids in humans . Recent structural predictions using AlphaFold2 have provided high-confidence models of CLN8's three-dimensional structure . The protein contains multiple transmembrane domains characteristic of the TLCD family . Key functional regions include conserved histidine and arginine residues (including H139 and R204), which are essential for enzymatic activity and are frequently mutated in patients with Batten disease . The active site appears to be located in a region that can accommodate the LPG substrate, with the conserved residues positioned to interact with the substrate headgroup .

How is CLN8 involved in neuronal ceroid lipofuscinoses (NCLs)?

CLN8 disease is one of the neuronal ceroid lipofuscinoses (NCLs), which represent the most common group of neurodegenerative diseases in childhood . Mutations in the CLN8 gene lead to progressive neurological deterioration characterized by seizures, dementia, ataxia, visual failure, and various forms of abnormal movement . The severity and progression rate of CLN8 disease can vary significantly, with some patients developing a protracted clinical course and milder symptoms . The connection between CLN8's biochemical function as a lysophosphatidylglycerol acyltransferase and the pathophysiology of NCL appears to involve disruption of lysosomal BMP synthesis, which is critical for proper lysosomal function and lipid metabolism .

Where is CLN8 protein localized within cells?

CLN8 primarily localizes to the endoplasmic reticulum (ER) and Golgi network . This localization is consistent with its role in the early steps of BMP biosynthesis, which begins in the ER/Golgi before the lipid is trafficked to lysosomes . Previous research has also described CLN8 as a cargo receptor that mediates the trafficking of soluble lysosomal proteins . The precise subcellular distribution may vary slightly between different cell types and experimental systems.

How does CLN8 function as a lysophosphatidylglycerol acyltransferase?

CLN8 catalyzes the acylation of R,S-lysophosphatidylglycerol (LPG) to form R,S-bis(monoacylglycero)phosphate (BMP), a critical phospholipid in lysosomes . The enzymatic reaction involves the transfer of a fatty acyl group from acyl-CoA to the headgroup of LPG . This reaction has been demonstrated in vitro using purified CLN8 protein, with the product identified by thin-layer chromatography (TLC) and liquid chromatography-mass spectrometry (LC-MS/MS) . The acyltransferase activity is time-dependent and shows substrate preference for certain fatty acyl-CoA species . The conserved residues in the TLCD domain are essential for this catalytic activity, as they appear to interact with the LPG headgroup based on molecular docking studies .

What is the proposed pathway for BMP synthesis involving CLN8?

Based on recent research, a model for BMP biosynthesis has been proposed with CLN8 playing a central role:

  • CLN8 catalyzes the acylation of R,S-LPG in the ER/Golgi to produce R,S-BMP intermediate

  • This molecule undergoes a rearrangement where the phosphoryl ester migrates from the sn-3 to the sn-1 position, releasing the sn-1 linked acyl chain

  • This migration, catalyzed by an unidentified enzyme, results in the formation of S,S-LPG intermediate

  • S,S-LPG is trafficked to the lysosome, where another enzyme (possibly CLN5) uses it to generate mature S,S-BMP

This pathway explains why fatty acyl-CoA synthesis is necessary for BMP biosynthesis and why BMP formation involves the removal of both acyl groups while retaining both glycerol moieties from the precursor PG during its conversion .

How do mutations in CLN8 affect its enzymatic function?

Several disease-causing mutations in CLN8 have been identified, including H139Y, R204C, and R204L . These mutations affect conserved histidine and arginine residues that are essential for the protein's acyltransferase activity . Bioinformatic analyses of CLN8 variants provide insights into their functional consequences:

  • The Q256E variant (c.766C>G) - This mutation changes glutamine to glutamate, introducing a negative charge that likely destabilizes the protein structure due to desolvation effects . This residue faces the inside of the protein, and the destabilization may induce conformational changes that spread throughout the protein and inhibit its activity .

  • The Y158C variant (c.473A>G) - This mutation affects a tyrosine residue that may be important for protein function or stability .

Evolutionary conservation analysis using ConSurf shows that these residues and their surrounding regions are highly conserved, suggesting their functional importance . The destabilizing effects of these mutations likely compromise CLN8's enzymatic activity, leading to reduced BMP synthesis and the consequent lysosomal dysfunction observed in Batten disease .

What methods can be used to study CLN8 acyltransferase activity in vitro?

Several complementary methods have been successfully used to assess CLN8 enzymatic activity:

  • Radiolabeled Assay: Using purified CLN8 with 18:1-LPG and [1-14C]-oleoyl-CoA, followed by thin-layer chromatography (TLC) to identify the radiolabeled reaction product relative to R,S-dioleoyl-BMP standard .

  • LC-MS/MS Analysis: Monitoring the BMP-specific monoacylglycerol fragment transition in time-course assays with purified CLN8, 18:1-LPG, and unlabeled acyl-CoA . This approach allows for precise quantification of reaction products.

  • Substrate Preference Assay: Using an equimolar acyl-CoA mix with 18:1-LPG to determine which fatty acyl-CoA species are preferentially utilized by CLN8 .

These methods can be combined with site-directed mutagenesis to investigate the role of specific residues in catalytic activity and substrate recognition.

How can recombinant CLN8 protein be produced and purified?

Recombinant CLN8 protein production typically involves:

  • Expression System Selection: Given that CLN8 is a membrane protein, expression systems that handle membrane proteins well (such as insect cells or specialized E. coli strains) are often used.

  • Construct Design: Addition of purification tags (such as His-tag or HA-tag) to facilitate purification . The specific tag type may be determined during the production process to optimize yield and activity .

  • Purification Strategy: Typically involves affinity chromatography followed by size exclusion chromatography to obtain pure, active protein .

  • Storage Considerations: Recombinant CLN8 is often stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Working aliquots can be kept at 4°C for up to one week, and repeated freezing and thawing should be avoided .

For dog CLN8 (UniProt ID: Q5JZQ7), the full amino acid sequence is available and can be used for recombinant expression of the complete protein (amino acids 1-288) .

What cellular models are appropriate for studying CLN8 function?

Several cellular models have proven useful for investigating CLN8 function:

These cellular models can be combined with lipidomic analysis to characterize changes in BMP and other phospholipid species.

What analytical techniques are most informative for CLN8 research?

Key analytical techniques for CLN8 research include:

  • Untargeted LC-MS Lipidomics: This approach allows comprehensive profiling of phospholipid species, including BMP, to assess the impact of CLN8 manipulation on cellular lipidomes .

  • Targeted LC-MS/MS: Provides more sensitive and specific quantification of particular lipid species of interest .

  • Structural Prediction and Analysis: Using tools like AlphaFold2 to predict protein structure and molecular docking to investigate substrate interactions .

  • Evolutionary Conservation Analysis: Tools like ConSurf can identify highly conserved residues that are likely functionally important .

  • Stability Change Prediction: Webservers like DUET can predict how mutations affect protein stability .

  • Confocal Microscopy: Useful for determining the subcellular localization of CLN8 and its variants .

These techniques provide complementary information about CLN8's structure, function, and role in disease.

How do compound heterozygous variants in CLN8 affect disease phenotype?

Compound heterozygous variants in the CLN8 gene (where different mutations are present on each allele) can lead to atypical presentations of CLN8 disease with variable clinical courses . For example, siblings carrying the compound heterozygous variants c.473A>G (p.Tyr158Cys) and c.766C>G (p.Gln256Glu) presented with milder phenotypes including mild epilepsy, cognitive decline, mild learning disability, attention-deficit/hyperactivity disorder (ADHD), and a markedly protracted course of motor decline . This phenotypic variability suggests that different combinations of mutations may have varying effects on CLN8 function, potentially retaining partial activity that modifies disease progression .

What are the structure-function relationships of disease-causing CLN8 mutations?

Bioinformatic analyses of CLN8 variants provide insights into how specific mutations affect protein structure and function:

These structure-function relationships provide a molecular basis for understanding the pathogenicity of different CLN8 mutations and may guide therapeutic approaches.

What insights can be gained from comparative analysis of CLN8 across species?

Comparative analysis of CLN8 across species can provide valuable insights:

  • Evolutionary Conservation: Highly conserved residues identified through phylogenetic analysis are likely functionally important and may represent critical sites for enzymatic activity or substrate binding .

  • Animal Models: Studies of CLN8 in different species, including dogs (Canis familiaris), can help understand the protein's function and the pathophysiology of related diseases .

  • Species-Specific Differences: Comparison of CLN8 sequences and structures across species may reveal adaptations related to differences in lipid metabolism or other physiological processes.

The dog CLN8 protein (UniProt ID: Q5JZQ7) shares significant homology with human CLN8 and can serve as a valuable model for studying the protein's function and its role in disease .

How can structural analysis of CLN8 inform therapeutic development?

Structural analysis of CLN8 using tools like AlphaFold2 can guide therapeutic development in several ways:

  • Drug Design: The predicted structure of CLN8, particularly the substrate-binding site and catalytic residues, can inform the design of small molecules that might modulate its activity .

  • Mutation-Specific Approaches: Understanding how specific mutations affect protein structure and function can guide the development of personalized therapeutic strategies, such as pharmacological chaperones for mutations that primarily affect protein stability .

  • Enzyme Replacement Strategy: Structural insights can inform the design of recombinant CLN8 proteins with enhanced stability or activity for potential enzyme replacement therapy.

  • Alternative Pathway Targeting: Knowledge of CLN8's role in BMP synthesis can guide approaches to bypass the affected pathway or enhance alternative routes of BMP production.

These structure-based approaches represent promising avenues for developing treatments for CLN8-related diseases, for which effective therapies are currently lacking.

What are the most promising directions for translational research on CLN8?

Several promising directions for translational research on CLN8 include:

  • Gene Therapy: Development of gene delivery systems to provide functional CLN8 to affected tissues, particularly in the central nervous system.

  • Substrate Reduction Therapy: Approaches to reduce the accumulation of toxic metabolites that result from CLN8 dysfunction.

  • BMP Supplementation Strategies: Methods to deliver BMP or its precursors to lysosomes, bypassing the need for CLN8 activity.

  • Small Molecule Screening: Identification of compounds that may enhance residual CLN8 activity in patients with partial loss-of-function mutations.

  • Early Biomarkers: Development of sensitive methods to detect alterations in BMP levels or other lipid species that might serve as diagnostic or prognostic biomarkers for CLN8 disease.

These approaches, informed by the growing understanding of CLN8's structure and function, offer hope for developing effective treatments for this currently incurable neurodegenerative disorder.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.