Recombinant Dog Protein transport protein Sec61 subunit beta (SEC61B)

Shipped with Ice Packs
In Stock

Description

Functional Role in Protein Translocation

The Sec61 complex (α, β, γ subunits) forms the ER membrane’s primary translocation channel. SEC61B facilitates:

  • Cotranslational translocation: Enhances the kinetic efficiency of nascent chain insertion into the ER membrane .

  • Interaction with signal peptidase: Cross-links with SPC25 (signal peptidase complex subunit) during ribosome binding, enabling coordinated cleavage of signal peptides .

  • Post-ER recycling: Detected in post-ER compartments, suggesting a role in translocon recycling .

Mechanistic Insights

  • Ribosome-dependent activity: SEC61B’s interaction with SPC25 occurs only in the presence of membrane-bound ribosomes, indicating a translocation-induced recruitment mechanism .

  • Non-essential but facilitative: While SEC61β is not strictly required for translocation, its absence reduces efficiency by ~50% in cotranslational assays .

Disease Relevance

  • Cancer: Overexpression of SEC61 subunits (e.g., SEC61G in glioblastoma) correlates with tumor progression and ER stress adaptation .

  • Diabetes: Mutations in SEC61A1 (α-subunit) disrupt calcium homeostasis and β-cell function, though direct links to SEC61B remain unexplored .

Applications in Research

Recombinant SEC61B is primarily used for:

  • ELISA/Western blotting: As an antigen or control protein .

  • ER stress studies: Investigating translocon dynamics during unfolded protein response .

  • Structural biology: Co-crystallization with ribosomes or signal peptidase components .

Comparative Analysis Across Species

FeatureDog SEC61BHuman SEC61B
Amino Acid Identity~95%100% (reference)
Recombinant Host SystemsYeast, E. coli Wheat germ, HEK293
Disease AssociationsNot yet characterizedCancer, diabetes, polycystic liver

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will then prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize development with the specified tag if possible.
Synonyms
SEC61B; Protein transport protein Sec61 subunit beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-96
Protein Length
Full Length of Mature Protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
PGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Uniprot No.

Target Background

Function
SEC61B is a component of the SEC61 channel-forming translocon complex. This complex mediates the transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER). SEC61B is also a component of a ribosome-associated ER translocon complex, playing a role in multi-pass membrane protein transport into the ER membrane and biogenesis. The SEC61 channel collaborates with the translocating protein TRAM1 to import nascent proteins into the ER. It is essential for PKD1/Polycystin-1 biogenesis.
Database Links
Protein Families
SEC61-beta family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the basic role of Sec61B in the Sec61 translocon complex?

Sec61B functions as an essential auxiliary subunit of the Sec61 translocon complex, which forms the core of the protein-conducting channel in the endoplasmic reticulum (ER) membrane. While not contributing substantially to the structural core of the Sec61 complex, Sec61B provides critical support to the Sec61α/γ sub-complex that forms the primary translocation channel. Research indicates that Sec61B facilitates the stability of the complex and assists in the proper functioning of protein translocation .

Sec61B is particularly important for efficient docking of nascent proteins during co-translational translocation. Cross-linking studies have revealed that Sec61B directly interacts with nascent transmembrane domains (TMDs) during their integration process, serving as a contact point before these domains are fully inserted into the lipid bilayer . This interaction occurs in the cytosolic vestibule of the Sec61 channel, suggesting that Sec61B helps guide hydrophobic protein segments toward the lateral gate of the translocon.

How does Sec61B participate in calcium regulation in the ER?

Recent research has identified a novel role for Sec61B in regulating calcium flux between the ER lumen and cytosol. The SEC61 translocon complex functions as a channel for ER calcium leak, with Sec61B playing a particularly important role in this process . Experimental data indicates that overexpression of SEC61B in cultured cells results in increased calcium flux from the ER to the cytosol, coupled with decreased protein synthesis capacity .

In hyperglycemic conditions, particularly relevant to diabetes models, platelets show increased SEC61B expression. This upregulation correlates with enhanced calcium mobilization to the cytosol and diminished protein synthesis compared to normoglycemic controls . The mechanism appears to involve ER stress triggering increased SEC61B expression, which subsequently enhances ER calcium leak into the cytosol. This calcium dysregulation may contribute to platelet hyperactivity observed in diabetic conditions.

What structural features distinguish Sec61B from other Sec61 complex subunits?

Sec61B is notably less conserved across species compared to the α and γ subunits, suggesting a more specialized evolutionary role . Structurally, it consists of a single transmembrane domain with cytosolic and lumenal portions. Cryo-EM studies have revealed that Sec61B peripherally associates with the main α subunit within the membrane .

The localization of Sec61B places it in close proximity to the lateral gate of the Sec61 complex, where it may influence the opening and closing of this critical feature during protein translocation. Molecular dynamics simulations suggest that Sec61B may prevent lipids from invading the translocation channel through the open lateral gate during protein integration into the membrane . This protective function could be essential for maintaining the integrity of the translocation process.

What are the recommended approaches for studying SEC61B interactions with nascent peptides?

For investigating interactions between SEC61B and nascent peptides, site-specific crosslinking techniques have proven highly effective. The bis-maleimidohexane (BMH) crosslinking method is particularly valuable as it can covalently link solvent-accessible cysteines that lie within approximately 13 Å of each other . This technique allows researchers to trap and analyze transient interactions during the dynamic protein translocation process.

Experimental protocol should include:

  • Generation of ribosome-nascent chain complexes (RNCs) of varying lengths

  • Introduction of strategically placed cysteine residues in both the nascent peptide and SEC61B

  • Application of BMH crosslinker under controlled conditions

  • Analysis of crosslinked products via immunoprecipitation and western blotting

The choice of nascent peptide is critical - transmembrane domain-containing proteins like TNFα provide excellent model substrates. In published experiments, TNFα 126-mers with native cysteines at positions 30 and 49 yielded successful crosslinks to SEC61β when treated with cotransin (CT8), a Sec61 inhibitor that traps nascent TMDs in the cytosolic vestibule .

How can recombinant SEC61B be effectively expressed and purified for functional studies?

Expression and purification of recombinant SEC61B presents challenges due to its transmembrane nature and functional dependence on other Sec61 complex components. The most successful approach involves co-expression with at least Sec61γ to form a stable sub-complex. The Sec61α/γ sub-complex has been demonstrated to function in ribosome-nascent chain (RNC) targeting and translocation assays, providing a simplified system for studying SEC61B function .

Recommended protocol:

  • Use baculovirus expression system in Sf21 insect cells for co-expression of FLAG-tagged Sec61α and untagged Sec61γ

  • Verify complex formation through co-purification with approximately 1:1 stoichiometry

  • Confirm proper folding through functional assays such as photo-affinity labeling with cotransin probes

  • Validate functionality by demonstrating BMH crosslinks between recombinant Sec61α and nascent TMDs

This approach has successfully produced recombinant Sec61α/γ complexes that behave similarly to native complexes in canine pancreatic microsomes, indicating correct folding and functionality . For dog SEC61B specifically, codon optimization for the expression system may improve yield and stability.

What methods are effective for measuring SEC61B's influence on calcium flux?

To quantify SEC61B's role in calcium regulation, researchers should employ a combination of calcium imaging techniques and protein expression manipulation. Based on successful approaches in the literature, the following methodology is recommended:

This multifaceted approach allows correlation between SEC61B expression levels, calcium flux measurements, and functional outcomes like protein synthesis efficiency. In published studies, cells overexpressing SEC61B demonstrated increased calcium flux coupled with decreased protein synthesis . Similar methodologies applied to platelets from hyperglycemic versus normoglycemic conditions revealed comparable patterns, strengthening the mechanistic connection.

How does SEC61B expression change in diabetic conditions, and what experimental models best demonstrate this?

SEC61B exhibits significant upregulation in diabetic conditions, with both human and mouse models showing consistent patterns. Proteomic analysis of platelets from matched cohorts (34 non-diabetic vs. 42 type 2 diabetic individuals) revealed increased SEC61B expression in diabetic samples . This human data was corroborated in mouse models of hyperglycemia, indicating an evolutionarily conserved response.

For studying this phenomenon, the following experimental models have proven effective:

  • Human cohort studies: Match participants by age, sex, and coronary artery disease burden to isolate diabetes-specific effects

  • Mouse hyperglycemia models: Both genetic (db/db) and streptozotocin-induced diabetes models show SEC61B upregulation

  • In vitro hyperglycemia: Cultured megakaryocytes exposed to high glucose conditions demonstrate increased SEC61B expression

  • ER stress inducers: Direct induction of ER stress in platelets increases SEC61B expression independent of hyperglycemia

The connection to ER stress appears particularly important, as SEC61B upregulation in megakaryocytes (platelet precursors) correlates with markers of ER stress in diabetic models . This suggests a mechanism where hyperglycemia triggers ER stress, leading to increased SEC61B expression and subsequent alterations in calcium homeostasis and platelet function.

What is the relationship between SEC61B, ER stress, and platelet function in pathological states?

Research indicates a mechanistic pathway connecting SEC61B upregulation to platelet hyperactivity through ER stress and calcium dysregulation. The proposed sequence involves:

  • Hyperglycemia induces ER stress in megakaryocytes and platelets

  • ER stress triggers increased SEC61B expression

  • Elevated SEC61B enhances ER calcium leak into the cytosol

  • Increased cytosolic calcium promotes platelet hyperactivation

  • Platelet hyperactivity contributes to adverse cardiovascular events

Supporting this model, in vitro induction of ER stress independently increases platelet SEC61B expression and markers of platelet activation . Hyperglycemic mouse platelets show both increased cytosolic calcium mobilization and reduced protein synthesis compared to normoglycemic controls, consistent with the effects of SEC61B overexpression in cultured cells.

This pathophysiological mechanism may explain the higher platelet reactivity observed in diabetic individuals, which is associated with increased risk of adverse cardiovascular events. The SEC61B-calcium axis represents a potential therapeutic target for addressing platelet dysfunction in diabetes.

How does SEC61B contribute to the gating mechanisms of the Sec61 translocon?

SEC61B plays a nuanced role in the complex gating mechanisms of the Sec61 translocon. The Sec61 channel features two primary gates: a vertical gate controlled by the plug domain and a lateral gate formed between TM2 and TM7 of the α subunit . While SEC61B itself is not directly part of either gate, structural and functional studies suggest it influences their operation.

Cryo-EM structures of the Sec complex reveal that SEC61B associates peripherally with the main channel formed by Sec61α. This positioning places SEC61B in proximity to the lateral gate, where it may:

  • Stabilize partially opened conformations of the lateral gate

  • Prevent inappropriate lipid infiltration when the lateral gate is open

  • Facilitate the movement of transmembrane domains from the channel into the lipid bilayer

Molecular dynamics simulations support a model where SEC61B acts as a barrier preventing lipids from invading the translocation channel through the open lateral gate . This function would be particularly important during the integration of transmembrane proteins, when the lateral gate must remain open while maintaining the integrity of the translocation pathway.

What structural techniques have been most informative for elucidating SEC61B's position and function in the translocon complex?

The most valuable structural insights into SEC61B have come from a combination of complementary techniques:

  • Cryo-electron microscopy (Cryo-EM): Provides medium to high-resolution structures of the entire translocon complex, revealing SEC61B's position relative to other components and the membrane

  • Site-specific crosslinking: Maps specific interaction points between SEC61B and nascent peptides or other translocon components

  • Molecular dynamics simulations: Models dynamic behaviors not captured in static structures, particularly interactions with lipids and water

  • AlphaFold prediction: Supplies structural models that can be fitted to lower-resolution cryo-EM densities

Recent cryo-EM structures have achieved sufficient resolution to visualize SEC61B's association with the core complex. For example, a structure of the ribosome-Sec61 complex showed binding of an ordered heterotetrameric translocon-associated protein (TRAP) complex, with TRAP-γ anchored at positions adjacent to SEC61 . Additionally, crosslinking studies identified Cys13 of Sec61α as the specific residue that interacts with the transmembrane domain of nascent peptides, placing this interaction near the cytosolic tip of the lateral gate .

How do mutations in the SEC61 complex affect the functional interaction with SEC61B?

These mutations demonstrate how allosteric effects propagate through the SEC61 complex:

  • Mutations in the lumenal plug region of Sec61α affect cotransin binding

  • This alters the ability of cotransin to trap nascent transmembrane domains in the cytosolic vestibule

  • The changed conformational state impacts interactions with SEC61B

Functional studies confirm that cells expressing Sec61α mutants (M136T or R66I) show dramatically reduced sensitivity to cotransin in both proliferation and protein translocation assays. Photo-crosslinking assays with recombinant proteins demonstrated that these mutations directly reduce cotransin binding to Sec61α .

This interplay between mutations, inhibitor binding, and SEC61B function highlights the complex allosteric network within the translocon and provides tools for dissecting the mechanisms of protein translocation.

How conserved is SEC61B across species, and what does this reveal about its functional importance?

SEC61B exhibits notably lower conservation across species compared to the other subunits of the Sec61 complex, particularly Sec61α and Sec61γ . This divergence pattern suggests that while the core translocation mechanism is highly conserved, SEC61B may have evolved more specialized functions in different organisms.

Key comparative observations include:

  • The β subunit is poorly conserved across species compared to α and γ subunits

  • Despite this sequence divergence, the structural position and general function appear maintained

  • SEC61B is not essential for basic translocon function, as the Sec61α/γ sub-complex can function in RNC targeting and translocation assays under certain conditions

  • The degree of SEC61B's involvement in calcium regulation may vary between species, potentially correlating with evolutionary adaptations in calcium signaling

The relatively lower conservation of SEC61B suggests it may serve accessory functions that have been adapted to the specific physiological needs of different organisms. This pattern is consistent with its emerging role in specialized processes like calcium regulation and platelet function, which may have evolved distinct regulatory mechanisms across species.

What functional differences exist between SEC61B in prokaryotic versus eukaryotic translocation systems?

While prokaryotes utilize the related SecY complex rather than Sec61, comparative analysis reveals important functional distinctions in the role of auxiliary subunits between these systems:

  • Membrane protein integration: In eukaryotes, C-terminally located α-helical domains are sufficient to promote translocation, whereas in bacteria, α-helical domains must precede intrinsically disordered domains (IDDs) or β-strands

  • Channel activation mechanisms: Eukaryotic SEC61B works cooperatively with Sec62 and Sec63 to activate the channel, while prokaryotic systems rely on different partners like SecA

  • Calcium regulation: The role of SEC61B in calcium leak appears to be a eukaryotic adaptation not present in prokaryotic systems, reflecting the evolution of the ER as a calcium store

  • Specialized functions: Eukaryotic SEC61B has evolved additional roles beyond basic translocation, including potential involvement in pathological conditions like platelet hyperactivation in diabetes

These differences highlight how the eukaryotic protein translocation machinery has evolved greater complexity and regulatory capacity compared to prokaryotic systems. The expansion of intrinsically disordered domains in eukaryotic proteomes may have driven co-evolution of adaptive pathways to increase the transport capacity of the Sec61 translocon , with SEC61B potentially playing a specialized role in this adaptation.

What are the optimal protocols for investigating SEC61B's role in transmembrane domain integration?

To effectively study SEC61B's function in transmembrane domain integration, researchers should implement a multi-faceted approach that captures both structural interactions and functional outcomes:

  • Ribosome-nascent chain (RNC) preparation:

    • Program ribosomes with mRNAs encoding model transmembrane proteins (e.g., TNFα)

    • Generate stalled RNCs of defined lengths using translation arrest sequences

    • Purify RNCs through sucrose cushion centrifugation

  • Cotransin-assisted trapping:

    • Apply cotransin (CT8) at appropriate concentrations (50-200 nM)

    • This traps nascent TMDs in the cytosolic vestibule of Sec61

    • Creates a stable pre-integration intermediate for analysis

  • Site-specific crosslinking analysis:

    • Introduce cysteine residues at strategic positions in both the nascent chain and SEC61B

    • Apply BMH crosslinker to capture interactions within ~13 Å distance

    • Analyze crosslinked products via immunoprecipitation and western blotting

  • Membrane integration assay:

    • Assess successful integration using protease protection assays

    • Compare wild-type SEC61B to mutant variants or altered expression levels

    • Quantify integration efficiency under various conditions

This combined approach has successfully demonstrated that SEC61B directly interacts with nascent transmembrane domains docked at the cytosolic tip of the lateral gate of Sec61α, providing mechanistic insight into how SEC61B facilitates the integration process .

How can researchers effectively investigate the dual roles of SEC61B in protein translocation and calcium regulation?

To comprehensively study SEC61B's dual functionality, researchers should implement parallel experimental systems that address both protein translocation and calcium regulation:

  • Translocation efficiency assessment:

    • In vitro translation systems with microsomal membranes

    • Pulse-chase experiments tracking secretory protein maturation

    • Protease protection assays to quantify translocation completion

    • SDS-PAGE and autoradiography for direct visualization of translocation intermediates

  • Calcium dynamics measurement:

    • Real-time calcium imaging using ratiometric indicators (Fura-2 AM)

    • ER calcium store depletion experiments with thapsigargin

    • Calcium flux quantification under varied SEC61B expression levels

    • Correlation of calcium measurements with functional outcomes

  • Manipulating SEC61B expression:

    • Generate stable cell lines with inducible SEC61B expression

    • Utilize CRISPR/Cas9 for precise genomic editing

    • Transfect SEC61B mutants designed to separate translocation and calcium regulatory functions

    • Rescue experiments in SEC61B-depleted backgrounds

  • Disease model integration:

    • Implement hyperglycemic conditions to mimic diabetes

    • Induce ER stress through standard agents (tunicamycin, thapsigargin)

    • Measure both calcium dynamics and protein translocation efficiency

    • Connect findings to physiological outcomes (e.g., platelet activation)

This comprehensive approach allows researchers to dissect how SEC61B contributes to both processes and determine whether these functions can be separated or are mechanistically linked.

What are the most promising therapeutic targets related to SEC61B dysfunction in disease states?

Recent findings connecting SEC61B upregulation to platelet hyperactivity in diabetes open several promising therapeutic avenues:

  • SEC61B expression modulation: Developing compounds that normalize SEC61B expression levels in hyperglycemic conditions could potentially reduce platelet hyperactivity

  • Targeted calcium leak regulation: Small molecules that specifically modulate SEC61B's role in calcium leak, without disrupting essential protein translocation functions

  • ER stress attenuation: Addressing the upstream ER stress that triggers SEC61B upregulation could prevent the cascade leading to platelet dysfunction

  • Allosteric modulators: Compounds similar to cotransin that can allosterically modulate SEC61 complex function might be tailored to specifically address pathological calcium leak

The ideal therapeutic approach would target the pathological aspects of SEC61B function while preserving its essential role in protein translocation. Research should focus on identifying the structural determinants that distinguish these functions and developing compounds with appropriate selectivity profiles.

What experimental approaches might reveal new functions of SEC61B beyond protein translocation and calcium regulation?

To uncover novel functions of SEC61B, researchers should consider these innovative approaches:

  • Interactome mapping:

    • Proximity labeling techniques (BioID, APEX)

    • Co-immunoprecipitation with quantitative proteomics

    • Investigation of temporal changes in interactome during cellular stress

  • Cell-type specific functions:

    • Single-cell RNA-seq to identify correlation patterns

    • Tissue-specific knockout models

    • Specialized cell types with unique secretory demands

  • Post-translational modification analysis:

    • Comprehensive phosphoproteomic analysis

    • Investigation of ubiquitination and other modifications

    • Connection of modifications to functional states

  • Non-canonical roles in organelle communication:

    • Focus on ER-mitochondria contact sites

    • Examination of roles at ER-plasma membrane junctions

    • Potential involvement in unconventional secretion pathways

These approaches could reveal unexpected functions of SEC61B in cellular processes beyond the currently established roles, potentially identifying new therapeutic targets or fundamental biological mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.