Recombinant Dog Signal peptidase complex subunit 2 (SPCS2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Dog Signal Peptidase Complex Subunit 2 (SPCS2)

Recombinant Dog Signal Peptidase Complex Subunit 2 (SPCS2) is a protein expressed in E. coli that corresponds to the full-length dog signal peptidase complex subunit 2 (SPCS2) . SPCS2, also known as signal peptidase complex subunit 2, is a component of the signal peptidase complex (SPC) . The SPC is responsible for catalyzing the cleavage of N-terminal signal sequences from nascent proteins as they are translocated . This process is essential for the proper folding and localization of proteins in eukaryotic cells .

Function and Significance

The signal peptidase complex (SPC) plays a crucial role in the processing of secretory proteins by cleaving their signal sequences . SPCS2, as a subunit of the SPC, is vital for the complex's function . Research indicates that SPCS2 modulates the properties of the SPC and its surrounding membrane environment, which enhances the complex’s ability to differentiate between signal peptides and signal-anchored sequences .

Specifically, SPCS2 influences substrate and cleavage site selection within the SPC . The C-terminal domain of Spc2 is critical for signal sequence recognition, potentially preventing signal sequences with long n-regions from entering the transmembrane window .

Research Findings

  • Impact on Cleavage Efficiency: Studies on yeast cells have demonstrated that the absence or mutation of Spc2 compromises the SPC's ability to discriminate between substrates and identify cleavage sites .

  • Modulation of Substrate Recognition: SPCS2 influences the SPC's preference for signal sequences based on the length of their n-regions. The C-terminal domain of Spc2 may sterically hinder signal sequences with longer n-regions from accessing the transmembrane window, making signal peptides with shorter n-regions preferable substrates .

  • Alteration of Membrane Environment: CGMD simulations indicate that Spc2 contributes to the thinning of the membrane within the transmembrane window of the SPC. This thinning is crucial for accommodating signal peptides with shorter h-regions, while the absence of Spc2 leads to a thicker membrane environment that alters substrate recognition properties .

Potential Applications

Recombinant canine SCF has shown promise in treating certain chronic hypoproliferative disorders of hematopoiesis . Further research could explore its applications in treating blood cell disorders in dogs .

Data Table

FeatureDescription
Protein NameRecombinant Full Length Dog Signal Peptidase Complex Subunit 2 (SPCS2)
SourceE. coli
TagHis-tagged
Amino Acid SequenceResidues 2-226 of SPCS2 (Q28250)
Molecular WeightVaries depending on post-translational modifications.
PurityData not found in the provided documents.
Biological ActivityComponent of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated . Modulates substrate- and cleavage site-selection .
ApplicationsResearch in protein processing, SPC function, and drug discovery .
Related Gene InformationSPCS2 signal peptidase complex subunit 2 [ Homo sapiens (human) ]

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPCS2; SPC25; Signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-226
Protein Length
Full Length of Mature Protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
SPCS2
Target Protein Sequence
AAASAQGGRTGGGGGSSGPGGGPTCGSGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLATERKIK
Uniprot No.

Target Background

Function
A component of the microsomal signal peptidase complex. This complex removes signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.
Database Links
Protein Families
SPCS2 family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of canine SPCS2 in the signal peptidase complex?

Canine SPCS2 is a critical component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the endoplasmic reticulum lumen. SPCS2 enhances the enzymatic activity of the SPC and facilitates interactions between different components of the translocation site .

Specifically, SPCS2 modulates substrate recognition and cleavage site selection. Research demonstrates that SPCS2 promotes cleavage of signal sequences with short n-regions (N# < 16) while reducing cleavage of those with long n-regions (N# > 16), suggesting it helps sharpen discrimination between signal peptides (SPs) and signal-anchored sequences (SAs) .

The canine microsomal signal peptidase was previously isolated as a complex of five subunits (25, 22/23, 21, 18, and 12 kDa), with SPCS2 corresponding to the 25 kDa subunit . When investigating this protein, researchers should note that its absence or mutation can compromise the discrimination between substrates and identification of cleavage sites by the SPC .

How does canine SPCS2 structure compare to orthologs across species?

Canine SPCS2 shares significant structural similarity with its mammalian orthologs. Both the human SPCS2 and yeast Spc2 structures are well conserved, constituting most of the cytosolic part of the SPC . Comparative sequence analysis reveals:

SpeciesSequence Homology to Canine SPCS2Key Conserved DomainsNotable Differences
HumanHigh (>90% similarity)C-terminal domain, transmembrane segmentsMinimal variation in cytosolic domain
YeastModerate (~60% similarity)C-terminal cytosolic domainDifferences in transmembrane topology
Fungi (e.g., F. oxysporum)Limited (~40% similarity)Functional core domainsSignificant divergence in regulatory regions

Research methodologies for cross-species comparison should include:

  • Multiple sequence alignment using programs like MUSCLE or Clustal Omega

  • Structural modeling using AlphaFold2-Multimer for predicting species-specific differences

  • Functional complementation assays to test interchangeability of SPCS2 across species

The C-terminal domain of SPCS2 is particularly important for N-length dependent signal sequence cleavage across species, suggesting evolutionary conservation of this functional domain .

What expression systems are most effective for producing recombinant canine SPCS2?

When expressing recombinant canine SPCS2, researchers should consider several expression systems, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, cost-effective, rapid productionLacks mammalian post-translational modifications, potential misfolding of membrane domainsUse specialized strains (e.g., Rosetta for rare codons), lower induction temperature (16-20°C), fusion tags (MBP, SUMO)
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, higher folding fidelityLower yields than bacterial systemsCodon optimization, inducible promoters, secretion signal optimization
Insect cellsProper folding of complex proteins, suitable for membrane proteinsMore expensive, slower productionBaculovirus optimization, cell density monitoring, harvest timing optimization
Mammalian cells (CHO, HEK293)Native-like post-translational modificationsHighest cost, complex media requirementsStable cell line development, serum-free adaptation, optimized transfection

Methodological considerations:

  • For structural studies, insect cell expression using the baculovirus system has proven effective for producing correctly folded SPC components .

  • For functional studies, yeast expression systems offer the advantage of potential complementation experiments in Spc2-deficient strains .

  • When investigating interactions with other SPC components, co-expression strategies should be employed to ensure proper complex formation .

The purification strategy should account for SPCS2's membrane protein nature, typically utilizing detergent solubilization (e.g., DDM, LMNG) followed by affinity chromatography with appropriate tags (His, FLAG) .

What are optimal purification methods for recombinant canine SPCS2?

Purifying recombinant canine SPCS2 presents challenges due to its membrane protein nature. A methodological approach should include:

  • Membrane Fraction Isolation:

    • Differential centrifugation to separate cellular components

    • Ultracentrifugation at 100,000 × g to collect membrane fractions

    • Washing steps to remove peripheral proteins

  • Solubilization Strategy:

    • Selection of appropriate detergents (recommended: DDM, LMNG, or GDN)

    • Optimization of detergent concentration (typically 1-2% for extraction, 0.01-0.05% for purification)

    • Buffer composition with stabilizing agents (glycerol, specific lipids)

  • Chromatography Approaches:

    • Affinity chromatography using epitope tags (His, FLAG, Strep)

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography for final polishing and complex integrity assessment

  • Complex Integrity Preservation:

    • Consider co-expression with other SPC components

    • Alkaline extraction of microsomes prior to solubilization or solubilization at alkaline pH causes partial dissociation of the SPC and should be avoided if intact complex is desired

    • Use of amphipols or nanodiscs for detergent removal and stabilization

Researchers should note that SPCS2 displaced from the complex under alkaline conditions demonstrates no signal peptide processing activity by itself, highlighting the importance of maintaining complex integrity for functional studies .

How does SPCS2 modulate substrate selectivity in the signal peptidase complex?

SPCS2 plays a sophisticated role in substrate selectivity through multiple mechanisms based on current research:

  • N-region Length Discrimination:

    • SPCS2 promotes cleavage of signal sequences with short n-regions (N# < 16)

    • It reduces cleavage of sequences with long n-regions (N# > 16)

    • This discrimination helps distinguish between signal peptides (SPs) and signal-anchored sequences (SAs)

  • Membrane Environment Modulation:

    • Coarse-grained molecular dynamics (CGMD) simulations reveal that SPCS2 influences membrane thickness at the center of the SPC

    • The membrane within the TM-window is approximately 3Å thinner with SPCS2 present compared to when it's absent

    • This thinning creates a environment where SPs with shorter h-regions fit optimally while excluding SAs with longer h-regions

  • C-terminal Domain Function:

    • The cytosolic C-terminal domain of SPCS2 is particularly critical for substrate discrimination

    • Truncation experiments (Spc2-ΔCD(58) and Spc2-ΔCD(23)) show that shorter N-length variants are less efficiently cleaved while longer N-length variants are more efficiently cleaved than in wild-type cells

    • This domain likely sterically prevents signal sequences with long n-regions from entering the transmembrane window

For experimental investigation of these mechanisms, researchers should consider:

  • Designing signal sequence variants with systematic variations in n-region length

  • Utilizing pulse-labeling experiments to capture early stages of protein maturation

  • Employing CGMD simulations of membrane-embedded SPC complexes with and without SPCS2

What cellular consequences result from SPCS2 dysfunction or mutation?

SPCS2 dysfunction leads to several cellular consequences with significant implications for cellular homeostasis and disease models:

  • Altered Protein Processing:

    • Compromised discrimination between substrates and cleavage site identification

    • Increased misprocessing of signal sequences, affecting protein localization and function

  • Unfolded Protein Response (UPR) Activation:

    • Quantitative mass spectrometry data shows markedly increased abundance of ER chaperones (Kar2 and Pdi1) in SPCS2-deficient cells

    • This indicates UPR triggering when N-length-dependent substrate discrimination is compromised

  • Potential Disease Associations:

    • In humans, SPCS2 gene has been associated with Spinocerebellar Ataxia 13

    • In canines, SPCS2 mutations could potentially lead to developmental and neurological disorders

    • Experimental disease models using SPCS2 mutations could provide insights into secretory pathway disorders

Impact LevelObserved Effect in SPCS2 DysfunctionExperimental Evidence
MolecularAltered signal sequence cleavage patternPulse-labeling experiments
CellularER stress and UPR activationIncreased Kar2/Pdi1 levels via mass spectrometry
OrganismalPotential developmental/neurological defectsAssociation with neurological diseases in humans

Research approaches to investigate SPCS2 dysfunction should include:

  • CRISPR/Cas9-mediated genome editing to create specific mutations

  • Proteomics analysis to identify substrates most affected by SPCS2 dysfunction

  • Tissue-specific conditional knockout models to assess organ-specific effects

How can molecular dynamics simulations enhance our understanding of canine SPCS2 function?

Molecular dynamics (MD) simulations provide powerful insights into SPCS2 function that complement experimental approaches:

  • Membrane Environment Modeling:

    • Coarse-grained molecular dynamics (CGMD) simulations reveal that the membrane within the transmembrane window of the SPC is thinner compared to bulk membrane

    • With SPCS2 present, this thinning is enhanced by approximately 3Å compared to SPC lacking SPCS2

    • This difference corresponds to the length difference between α-helices of 15 and 17 residues, explaining substrate selectivity patterns

  • Implementation Methodology:

    • Start with AlphaFold2-Multimer predictions of the canine SPC complex structure

    • Embed the complex in a lipid bilayer mimicking ER membrane composition

    • Run simulations with and without SPCS2 to analyze membrane deformation effects

    • Measure membrane thickness profiles across the complex

  • Substrate Interaction Simulations:

    • Model interactions between signal sequences of varying n-region and h-region lengths

    • Simulate docking of these sequences into the SPC active site

    • Analyze energetics of substrate binding and positioning relative to catalytic residues

  • Mutational Analysis:

    • Generate in silico mutations of key SPCS2 residues

    • Predict effects on complex stability, membrane deformation, and substrate interactions

    • Guide experimental mutagenesis studies based on simulation predictions

Researchers can use these simulations to:

  • Predict outcomes of mutations before experimental testing

  • Identify key interaction surfaces for further investigation

  • Understand dynamic processes not easily captured by static structural methods

  • Generate hypotheses about substrate selectivity mechanisms

What experimental strategies can best elucidate SPCS2 interactions with other signal peptidase complex components?

Understanding SPCS2 interactions with other SPC components requires multifaceted experimental approaches:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Tag SPCS2 with GFP or other affinity tags

    • Perform immunoprecipitation under conditions that preserve complex integrity

    • Identify interacting proteins by mass spectrometry

    • This approach has successfully identified all signal peptidase subunits in SPCS2 immunoprecipitation experiments

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse SPCS2 and potential interaction partners with complementary fragments of a fluorescent protein

    • Observe reconstituted fluorescence upon interaction in living cells

    • Quantify interaction strength through fluorescence intensity measurements

  • Crosslinking Coupled with Mass Spectrometry:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest crosslinked complexes and identify crosslinked peptides by mass spectrometry

    • Map interaction interfaces at amino acid resolution

  • Mutagenesis Studies:

    • Generate specific mutations in SPCS2 domains

    • Assess effects on complex formation and stability

    • Examples include C-terminal truncations (Spc2-ΔCD(58), Spc2-ΔCD(23)) and transmembrane replacements (Spc2-TM2*)

  • Quantitative Interaction Analysis:

    • Measure relative protein abundances of Sec11, Spc3, Spc2, and other components

    • Western blotting and quantitative mass spectrometry approaches can verify complex stability

    • Compare wild-type with mutant forms to identify critical interaction domains

Research has shown that SPCS2 interacts with the β subunit of the Sec61 translocon in yeast and mammals, mediating transient interactions between the SPC and the Sec61 translocon, although this connector role is not essential for function .

How can recombinant canine SPCS2 be used for structure-function relationship studies?

Structure-function relationship studies of recombinant canine SPCS2 can be approached through:

  • Domain Mapping and Mutagenesis:

    • Generate systematic truncations and point mutations

    • Two critical regions to target:
      a) C-terminal cytosolic domain (crucial for n-region length discrimination)
      b) Transmembrane segments (important for membrane thinning effects)

    • Functional assays should assess:

      • Signal sequence cleavage efficiency

      • Substrate specificity patterns

      • Complex formation with other SPC components

  • Chimeric Protein Analysis:

    • Create hybrid proteins swapping domains between canine, human, and yeast SPCS2

    • Test in complementation assays using SPCS2-deficient cells

    • Identify species-specific functional elements

  • Structural Biology Approaches:

    • Cryo-EM of the intact SPC complex with SPCS2

    • X-ray crystallography of soluble domains

    • NMR studies of isolated domains

    • Compare with the existing human SPC cryo-EM structure to identify conserved features

  • Correlation of Structure with Function:

    Structural ElementFunctional RoleExperimental Approach
    C-terminal domainn-region length discriminationTruncation series (e.g., ΔCD58, ΔCD23) with functional assays
    Transmembrane segmentsMembrane thinning, complex assemblyTM replacement (e.g., Spc2-TM2*) and CGMD simulations
    N-terminal regionPotential regulatory interactionsN-terminal tagging effects, deletion analysis
  • In vivo Relevance Assessment:

    • Introduce mutations in cell models or animal models

    • Assess phenotypic consequences

    • Correlate with biochemical findings

    • Monitor UPR activation as a readout for dysfunction

What are the implications of SPCS2 research for understanding protein trafficking disorders?

SPCS2 research has significant implications for understanding protein trafficking disorders:

  • Pathogenic Mechanisms in Signal Sequence Processing:

    • SPCS2 dysfunction leads to altered discrimination between substrate types

    • This results in improper signal sequence cleavage patterns

    • Consequences include:

      • Proteins with uncleaved signal sequences may misfold or be mistargeted

      • Inappropriate cleavage of signal-anchored sequences may release proteins intended to remain membrane-bound

      • Both scenarios can trigger cellular stress responses

  • Unfolded Protein Response (UPR) Activation:

    • SPCS2 deficiency or mutation triggers UPR activation

    • This is evidenced by increased levels of ER chaperones Kar2 and Pdi1

    • Chronic UPR activation is associated with various diseases including:

      • Neurodegenerative disorders

      • Metabolic diseases

      • Cancer progression

  • Disease Associations and Models:

    • Human SPCS2 has been associated with Spinocerebellar Ataxia 13

    • Canine models with SPCS2 mutations could provide valuable insights into:

      • Neurodevelopmental disorders

      • ER stress-related diseases

      • Protein trafficking pathologies

  • Therapeutic Targeting Potential:

    • Understanding SPCS2 function could lead to novel therapeutic approaches:

      • Small molecules that modulate SPC activity

      • Peptides that target specific SPCS2 domains

      • Gene therapy approaches to correct SPCS2 deficiencies

  • Comparative Medicine Applications:

    • Dogs serve as excellent natural models for human disease

    • Canine SPCS2 studies may reveal conserved pathogenic mechanisms

    • The dog genome sequence and SNP map now make it possible for genome-wide association studies to identify genes responsible for diseases and traits

Researchers interested in this area should consider:

  • Screening for SPCS2 mutations in canine populations with suspected protein trafficking disorders

  • Developing cell and animal models with specific SPCS2 mutations

  • Employing systems biology approaches to map the network of affected proteins under SPCS2 dysfunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.