Recombinant Dog Somatostatin receptor type 1 (SSTR1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Dog SSTR1 is a cloned version of the native somatostatin receptor subtype 1 expressed in Canis lupus familiaris. It binds somatostatin peptides (e.g., somatostatin-14) to regulate hormone secretion, cell proliferation, and metabolic processes . This receptor couples with G proteins to inhibit adenylyl cyclase and modulate downstream signaling pathways, including phosphotyrosine phosphatase and Na+/H+ exchanger activity .

Key Features

  • Domain Architecture: Seven transmembrane helices typical of GPCRs, with extracellular N-terminal and intracellular C-terminal domains .

  • Ligand Specificity: Higher affinity for somatostatin-14 than -28 .

  • Signaling Pathways:

    • Pertussis toxin-sensitive Gαi/o proteins inhibit cAMP production .

    • Pertussis toxin-insensitive pathways activate phosphotyrosine phosphatase and mitogen-activated protein (MAP) kinase .

Molecular Dynamics

Studies on human SSTR1 homologs reveal ligand-binding pockets stabilized by hydrophobic interactions and hydrogen bonds with residues like Tyr^7.43 and Asn^3.35 . These insights are critical for extrapolating dog SSTR1 behavior in drug design .

Research Applications

Recombinant Dog SSTR1 is widely used in:

Table 1: Common Experimental Uses

ApplicationDescriptionSource
Ligand BindingScreening agonists/antistors via competitive assays
Structural StudiesCryo-EM and molecular dynamics simulations of receptor conformation
Antibody ValidationValidating SSTR1-specific antibodies (e.g., Bioss bs-1137R, Abcam ab140945)
Drug DevelopmentTesting subtype-selective somatostatin analogs for endocrine disorders

Expression Systems

Recombinant Dog SSTR1 is typically produced in E. coli or mammalian cell systems. Commercial variants include:

Table 3: Key Antibodies for Dog SSTR1 Research

AntibodyHostApplicationsReactivity
Bioss bs-1137RRabbitWB, ELISAHuman, Mouse, Dog
Abcam ab140945RabbitIHC-PHuman, Dog
Abcam ab137083RabbitWB, ICC/IFHuman, Dog

Sources:

Challenges and Future Directions

  • Species-Specific Variations: Structural differences between dog and human SSTR1 may affect ligand selectivity .

  • Heterodimerization: SSTR1 forms dimers with other SSTR subtypes (e.g., SSTR5), altering signaling outcomes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
SSTR1; Somatostatin receptor type 1; SS-1-R; SS1-R; SS1R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MFPNGTASSPSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAILI SFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLLR HWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLGV WVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAICL CYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQDD ATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKSR AYSVEDFQPENLESGGAVFRNGTCTSRITTL
Uniprot No.

Target Background

Function
Somatostatin receptor type 1 (SSTR1) is a receptor for somatostatin with a higher affinity for somatostatin-14 than -28. This receptor is coupled to the inhibition of adenylyl cyclase via pertussis toxin-sensitive G proteins. Additionally, it stimulates phosphotyrosine phosphatase and Na(+)/H(+) exchanger through pertussis toxin-insensitive G proteins.
Database Links

KEGG: cfa:403455

STRING: 9615.ENSCAFP00000020273

UniGene: Cfa.165

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Somatostatin Receptor Type 1 (SSTR1) and what is its role in canine physiology?

Somatostatin Receptor Type 1 (SSTR1) is a G-protein coupled receptor that belongs to the superfamily of somatostatin receptors characterized by seven transmembrane segments. In canines, as in other species, SSTR1 plays a critical role in mediating the effects of somatostatin, a peptide hormone that regulates diverse cellular functions including neurotransmission, cell proliferation, and endocrine signaling. SSTR1 functions primarily by inhibiting the release of various hormones and secretory proteins . In particular, SSTR1 has a higher binding affinity for somatostatin-14 compared to somatostatin-28, indicating its specificity in hormone recognition and response . The receptor's primary physiological function involves inhibitory regulation through its coupling to pertussis toxin-sensitive G proteins that inhibit adenylyl cyclase activity, thereby reducing intracellular cAMP levels .

How does SSTR1 differ from other somatostatin receptor subtypes in dogs?

In canines, SSTR1 exhibits distinct characteristics that differentiate it from other somatostatin receptor subtypes. Among the somatostatin receptor family, SSTR1, SSTR2, and SSTR5 are consistently expressed in canine tissues, while SSTR3 shows more limited expression, being detected in only about 33% of samples in studies of canine meningiomas . Unlike some other receptor subtypes, SSTR1 couples predominantly to Gi alpha 3 protein, which specifically mediates its inhibitory effect on adenylyl cyclase . This selective G-protein coupling represents a key distinguishing feature of SSTR1's signaling mechanism. Additionally, SSTR1 can form both homodimers and heterodimers with other receptors, including G-protein coupled receptors and receptor tyrosine kinases, providing another layer of functional diversity and regulation .

What are the primary signaling pathways associated with canine SSTR1?

Canine SSTR1 engages multiple signaling pathways that collectively mediate its biological effects. The primary signaling mechanisms include:

  • Inhibition of adenylyl cyclase: SSTR1 activation leads to inhibition of forskolin-stimulated cAMP formation with high potency (ED50 of 1.0 × 10^-9 M) . This inhibitory effect is mediated specifically by pertussis toxin-sensitive Gi alpha 3 protein, as demonstrated by studies using antisera against different G protein subunits .

  • Stimulation of inositol 1,4,5-trisphosphate formation: SSTR1 activation triggers inositol 1,4,5-trisphosphate formation in a dose-dependent manner with an ED50 of 4.0 × 10^-8 M . This pathway is also mediated by pertussis toxin-sensitive G proteins, suggesting multiple downstream effectors from the same G protein family .

  • Activation of phosphotyrosine phosphatase: SSTR1 stimulates phosphotyrosine phosphatase activity, which may contribute to its anti-proliferative effects in certain cell types .

  • Regulation of Na+/H+ exchanger: SSTR1 can stimulate Na+/H+ exchanger activity via pertussis toxin insensitive G proteins, indicating a divergent signaling pathway from its adenylyl cyclase inhibition mechanism .

These multiple coupling mechanisms enable SSTR1 to exert diverse cellular responses depending on the tissue context and physiological state.

What methods are most effective for evaluating SSTR1 expression in canine tissue samples?

For comprehensive evaluation of SSTR1 expression in canine tissue samples, researchers should employ complementary methodologies:

RNA Detection Methods:

  • RT-qPCR: Real-time quantitative PCR is highly sensitive for detecting SSTR1 mRNA expression. For optimal results, studies have employed protocols using activation at 95°C for 12 minutes, followed by 40 cycles at 95°C for a short 15-second denaturation step and a 60°C 1-minute annealing/extension phase . When comparing sample preparation methods, fresh frozen samples generally yield more consistent results than formalin-fixed paraffin-embedded (FFPE) samples, which often show lower detection rates .

Functional Assays:

  • Calcium Flux Assays: For functional validation of SSTR1 expression, calcium flux assays using specific cell lines (e.g., Chem-1 cells) expressing the receptor can be employed to measure receptor activation in response to agonists .

It is strongly recommended to use multiple methods in parallel, as each has distinct strengths and limitations for SSTR1 detection in canine samples.

How does the expression of SSTR1 in canine tumors impact potential therapeutic approaches?

The expression of SSTR1 in canine tumors, particularly meningiomas, has significant implications for developing targeted therapeutic strategies. Studies have consistently demonstrated that canine meningiomas express multiple SSTR subtypes, with SSTR1, SSTR2, and SSTR5 being detected in all samples examined, suggesting their potential as therapeutic targets . This expression pattern parallels findings in human tumors, where somatostatin receptors serve as targets for synthetic long-acting somatostatin analogues.

The therapeutic relevance stems from SSTR1's ability to inhibit cell proliferation and induce apoptosis when activated by appropriate ligands. Currently, the standard treatment for canine meningiomas includes radiotherapy, surgical excision, or combined therapy, but these approaches may result in recurrence or disease progression . The consistent expression of SSTRs in these tumors provides rationale for investigating adjunctive therapy with long-acting somatostatin analogues.

Research priorities should focus on:

  • Correlating SSTR1 expression levels with tumor characteristics and clinical outcomes

  • Developing canine-specific somatostatin analogues with high SSTR1 affinity

  • Conducting preclinical and clinical trials to evaluate the efficacy of somatostatin analogue treatment in SSTR1-expressing canine tumors

Importantly, while the expression data are encouraging, researchers should note that the therapeutic potential of targeting SSTR1 in canine tumors requires further validation through properly designed intervention studies, as current evidence primarily establishes receptor presence rather than confirmed therapeutic efficacy .

What are the challenges in producing functional recombinant dog SSTR1 in different expression systems?

Producing functional recombinant dog SSTR1 presents several system-specific challenges:

E. coli Expression System:

  • As a G-protein coupled receptor with seven transmembrane domains, SSTR1 contains multiple hydrophobic regions that often lead to protein misfolding and aggregation in bacterial systems .

  • Post-translational modifications crucial for SSTR1 function, such as glycosylation, are absent in prokaryotic expression systems.

  • Refolding protocols for solubilizing inclusion bodies frequently result in low yields of functional protein.

Yeast Expression System:

  • While superior to bacterial systems for membrane protein expression, yeast systems may introduce non-native glycosylation patterns that can affect receptor pharmacology .

  • Expression levels can be variable and may require extensive optimization of growth conditions and induction parameters.

Insect Cell/Baculovirus System:

  • This system provides better post-translational modifications but may still introduce differences in glycosylation compared to mammalian cells.

  • Scaling up production can be technically challenging and resource-intensive.

Mammalian Cell Expression:

  • Though offering the most native-like post-translational modifications and protein folding environment, mammalian expression systems typically yield lower protein quantities .

  • Higher production costs and more complex purification procedures due to the presence of numerous host cell proteins.

General Challenges Across Systems:

  • Maintaining the structural integrity of the seven transmembrane domains during solubilization and purification.

  • Preserving functional activity, particularly ligand binding and G-protein coupling capabilities.

  • Ensuring batch-to-batch consistency in receptor pharmacology and binding properties.

To address these challenges, researchers often employ fusion tags such as the Avi-tag biotinylation approach referenced in the available commercial preparations , which facilitates downstream applications while potentially enhancing protein stability and solubility.

What techniques are recommended for assessing SSTR1-mediated signaling in canine cell lines?

For comprehensive assessment of SSTR1-mediated signaling in canine cell lines, researchers should consider multiple complementary approaches:

cAMP Accumulation Assays:
The primary signaling pathway of SSTR1 involves inhibition of adenylyl cyclase, resulting in decreased cAMP levels. Forskolin-stimulated cAMP formation assays provide a robust method to measure this inhibitory effect . In established protocols, SSTR1 activation by somatostatin-14 demonstrates dose-dependent inhibition of cAMP production with an ED50 of approximately 1.0 × 10^-9 M .

Inositol Phosphate Measurement:
Since SSTR1 also stimulates inositol 1,4,5-trisphosphate formation, researchers should incorporate IP3 measurement assays . These assays typically show dose-dependent responses with an ED50 of around 4.0 × 10^-8 M for somatostatin-14 stimulation .

Calcium Flux Assays:

  • Protocol outline: Seed cells expressing SSTR1 in 96-well plates (50,000 cells/well)

  • Incubate for 24 hours in 5% CO2

  • Load cells with calcium-sensitive dye (e.g., Fluo-8-No-Wash Ca2+ dye)

  • Incubate for 90 minutes at 30°C in 5% CO2

  • Add SSTR1 agonists at varying concentrations and measure fluorescence output

  • Express data as percentage of maximal fluorescence signal after baseline correction

G-protein Coupling Analysis:
For detailed mechanistic studies, pertussis toxin sensitivity tests and G-protein subtype identification using specific antisera are recommended . These approaches revealed that Gi alpha 3 specifically mediates SSTR1's inhibitory effect on adenylyl cyclase, while antisera against Gi alpha 1/Gi alpha 2 had no blocking effect .

Phosphotyrosine Phosphatase Activity Assays:
SSTR1 activation stimulates phosphotyrosine phosphatase activity via pertussis toxin-insensitive G proteins . Measurement of this activity provides important insights into alternative signaling pathways activated by the receptor.

When designing these experiments, appropriate controls including pertussis toxin treatment (to block Gi/Go-mediated pathways) and comparison with other SSTR subtypes are essential for proper interpretation of results.

What controls should be included when evaluating the specificity of anti-SSTR1 antibodies in canine samples?

When evaluating the specificity of anti-SSTR1 antibodies for canine samples, researchers must implement a comprehensive set of controls to ensure reliable results:

Positive Controls:

  • Known SSTR1-expressing canine tissues: Based on expression studies, canine meningioma samples have been verified to express SSTR1 and can serve as positive controls .

  • Recombinant dog SSTR1 protein: Using purified recombinant protein provides a definitive positive control for antibody validation .

Negative Controls:

  • Tissues from SSTR1 knockout models: If available, tissues from genetically modified models lacking SSTR1 expression provide ideal negative controls.

  • Tissues known to lack SSTR1 expression: Careful selection based on published expression profiles.

  • Primary antibody omission: Process tissues with all reagents except the primary anti-SSTR1 antibody to assess secondary antibody non-specific binding.

  • Isotype controls: Use matched isotype control antibodies (e.g., rabbit IgG for rabbit-derived anti-SSTR1) to identify non-specific binding.

Specificity Controls:

  • Peptide competition/blocking: Pre-incubate the anti-SSTR1 antibody with excess SSTR1-specific peptide to block specific binding sites, which should eliminate true positive signals.

  • Cross-reactivity assessment: Test the antibody against other somatostatin receptor subtypes (SSTR2-5) to confirm specificity within the receptor family.

Western Blot Validation:
Western blotting should be performed to confirm antibody specificity before immunohistochemical applications . The expected molecular weight for SSTR1 is approximately 43 kDa . When using validated antibodies like UMB7 clone (ab137083), appropriate dilutions (1/500) should be employed .

Methodological Considerations:
Researchers should be aware that immunohistochemistry results for SSTR1 in canine tissues have shown diffuse background staining in some studies, necessitating careful interpretation . When possible, correlating protein detection with RNA expression data (RT-qPCR) provides additional confidence in antibody specificity .

What are the optimal protocols for purifying recombinant dog SSTR1 while maintaining its native conformation?

Purification of recombinant dog SSTR1 requires specialized protocols to maintain the receptor's native conformation and functionality:

Solubilization Strategies:
For membrane-bound receptors like SSTR1, gentle solubilization is critical. Use mild detergents such as n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), or digitonin at their critical micelle concentrations. These detergents effectively extract SSTR1 from membranes while preserving its tertiary structure and ligand-binding capabilities.

Affinity Purification Approaches:

  • Tag-based purification: The use of fusion tags facilitates purification while potentially stabilizing the receptor. Commercial recombinant dog SSTR1 preparations utilize various tags selected during the manufacturing process .

  • Biotinylation strategy: The Avi-tag biotinylation approach, where the AviTag peptide is specifically biotinylated by E. coli biotin ligase (BirA), offers high specificity for streptavidin-based purification . This method forms an amide linkage between biotin and the specific lysine of the AviTag, enabling efficient capture on streptavidin resins.

Stabilization During Purification:

  • Add appropriate ligands (somatostatin-14 is preferred over somatostatin-28 due to higher affinity) during purification to stabilize the receptor's active conformation.

  • Include cholesterol or cholesterol hemisuccinate in purification buffers to mimic the native membrane environment.

  • Maintain pH between 7.0-7.5 and use buffers containing 10-20% glycerol to enhance protein stability.

Quality Control Assessments:

  • SDS-PAGE analysis with target purity >85%

  • Functional validation through ligand binding assays

  • Circular dichroism spectroscopy to verify secondary structure integrity

  • Thermal stability assays to assess protein folding quality

Reconstitution Methods:
For functional studies, reconstitute lyophilized recombinant SSTR1 protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Gentle centrifugation of the vial before opening is recommended to bring contents to the bottom.

By carefully optimizing these parameters, researchers can obtain high-quality recombinant dog SSTR1 that maintains its native conformation and is suitable for downstream applications including structural studies, functional assays, and antibody development.

How can researchers effectively design experiments to study the pharmacological properties of recombinant dog SSTR1?

Designing robust experiments to characterize the pharmacological properties of recombinant dog SSTR1 requires a multi-faceted approach:

Ligand Binding Characterization:

  • Saturation binding assays: Determine the affinity (Kd) and maximum binding capacity (Bmax) using radiolabeled or fluorescently labeled somatostatin analogues. Note that SSTR1 has higher affinity for somatostatin-14 than somatostatin-28 .

  • Competition binding experiments: Assess the binding affinity of various unlabeled ligands by measuring their ability to displace a labeled reference compound.

  • Association/dissociation kinetics: Measure the rates of ligand binding (kon) and unbinding (koff) to understand receptor-ligand interaction dynamics.

Functional Response Assessment:

  • Dose-response curves: Establish full dose-response relationships for somatostatin-14 and related peptides, as SSTR1 activation inhibits forskolin-stimulated cAMP formation with an ED50 of approximately 1.0 × 10^-9 M .

  • Signal pathway identification: Incorporate pathway-specific inhibitors (e.g., pertussis toxin to block Gi/Go protein function) to dissect downstream mechanisms .

Receptor Desensitization and Trafficking:

  • Time-course experiments: Examine receptor response following continuous or repeated exposure to agonists.

  • Internalization studies: Quantify receptor endocytosis using fluorescently-labeled antibodies or ligands.

Experimental Controls and Standards:

  • Positive controls: Include native somatostatin-14 as a reference standard in all experiments .

  • Negative controls: Use receptor-negative cell lines or inactive receptor mutants to establish baseline signals.

  • System validation: Employ established SSTR1 ligands with known potencies to calibrate the experimental system.

Data Analysis Considerations:

  • Apply appropriate regression models (e.g., sigmoid dose-response fitting using GraphPad Prism) to extract pharmacological parameters .

  • Calculate and report standard pharmacological metrics including EC50/IC50 values, intrinsic efficacy, and binding constants.

  • When possible, perform statistical comparisons between recombinant dog SSTR1 and human SSTR1 to identify species-specific pharmacological properties.

By implementing this comprehensive experimental design, researchers can generate reliable pharmacological profiles of recombinant dog SSTR1 that contribute to both basic understanding and potential therapeutic applications.

What approaches are recommended for studying the interaction between SSTR1 and other signaling pathways in canine cells?

Studying the cross-talk between SSTR1 and other signaling pathways in canine cells requires sophisticated experimental approaches:

Pathway Crosstalk Analysis:

  • Sequential pathway activation: Activate SSTR1 before or after engaging other pathways to detect sequential dependencies. This approach revealed that SSTR1 can influence multiple signaling cascades, including both adenylyl cyclase inhibition and inositol phosphate formation .

  • Combinatorial pathway modulation: Simultaneously activate SSTR1 and other receptors to identify synergistic or antagonistic effects. For instance, examining how SSTR1 activation affects responses to growth factors or cytokines can reveal important regulatory mechanisms.

  • Pathway-specific inhibitors: Use selective inhibitors to block individual components of signaling cascades. The differential sensitivity to pertussis toxin demonstrated that SSTR1 couples to both pertussis toxin-sensitive and insensitive G proteins, mediating distinct downstream effects .

G-protein Coupling Analysis:

  • G-protein subtype identification: Use specific antisera or siRNA approaches targeting different G-protein subtypes. Studies employing antisera against Gi alpha 3 and Gi alpha 1/Gi alpha 2 demonstrated that Gi alpha 3 specifically mediates SSTR1's inhibitory effect on adenylyl cyclase .

  • BRET/FRET assays: Employ bioluminescence/fluorescence resonance energy transfer techniques to visualize direct interactions between SSTR1 and G-proteins or other signaling proteins in real-time.

Receptor Dimerization Studies:
Since somatostatin receptors can form homodimers and heterodimers with other G-protein coupled receptors and receptor tyrosine kinases , co-immunoprecipitation, protein complementation assays, or resonance energy transfer methods can be employed to investigate these interactions in canine cells.

Phosphoproteomic Analysis:
Mass spectrometry-based phosphoproteomic approaches can provide comprehensive identification of signaling pathways modulated by SSTR1 activation, revealing both canonical and non-canonical signaling events.

Experimental Design Considerations:

  • Include appropriate temporal resolution in experiments, as some pathway interactions may be transient

  • Carefully select cell models that express relevant pathway components at physiological levels

  • Consider performing experiments in primary canine cells where possible, as immortalized cell lines may exhibit altered signaling properties

By systematically applying these approaches, researchers can build a detailed understanding of how SSTR1 integrates with the broader signaling network in canine cells, potentially revealing novel therapeutic targets and regulatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.