Recombinant Dog Substance-K receptor (TACR2)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

The recombinant dog TACR2 protein is typically expressed in Escherichia coli (E. coli) systems for cost-effectiveness and scalability. For example, Cusabio’s product CSB-CF685631DO is produced in an in vitro E. coli expression system, yielding a full-length protein with high purity (>95%) . Alternative expression systems, such as yeast, baculovirus, and mammalian cells, are used for producing partial fragments of the receptor (Table 1) .

Table 1: Recombinant Dog TACR2 Protein Variants

Product CodeExpression SystemProtein Region
CSB-CF685631DOE. coliFull-length
CSB-YP685631DO1YeastPartial (Val92–Leu290)
CSB-EP685631DO1E. coliPartial (Val92–Leu290)
CSB-BP685631DO1BaculovirusPartial (Val92–Leu290)

Research Applications

Recombinant dog TACR2 is primarily used in:

  • Ligand-Binding Studies: Investigating interactions with neurokinin A and synthetic agonists/antagonists .

  • Immunoassays: Western blot (WB), immunohistochemistry (IHC), and ELISA (e.g., antibodies: CSB-PA050196, CSB-PA125699) .

  • Drug Development: Screening tachykinin receptor antagonists, such as saredutant and ibodutant, which showed mixed results in clinical trials for anxiety and irritable bowel syndrome (IBS) .

Challenges and Future Directions

Despite its utility, recombinant dog TACR2 faces challenges such as:

  • Structural Complexity: GPCR stability in E. coli systems requires optimization for functional studies .

  • Species-Specific Variations: Ligand affinity differences between dog and human TACR2 necessitate cautious extrapolation of findings .

Ongoing research aims to refine expression protocols and explore therapeutic targeting of TACR2 in veterinary and comparative medicine .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
TACR2; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MGAHAIVTDANISSSLENNTTGITAFSMPGWQLALWATAYLVLVLVAVTGNATVIWIILA HQRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCHFQNLFPITAMFVS IYSMTAIAADRYVAIVHPFQPRLSAPGTRAVIAGIWLLALALAFPQCFYSTITMDQGATK CVVVWPEDNGSKMLLLYHLVVIALIYVLPLLVMLLAYSVIGLTLWRREVPRHQVHGASLR HLRAKKKFVKTMVLVVVTFAICWLPYHFYFILGSFQEDIYYHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDKIELTHTPSLSARINRCHTKETFFMA GETALSPATNGQARGPQDGLPDEP
Uniprot No.

Target Background

Function

This receptor binds the tachykinin neuropeptide substance K (neurokinin A). It is coupled to G proteins, which activate a phosphatidylinositol-calcium second messenger system.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Substance-K receptor (TACR2) and its function?

Substance-K receptor, encoded by the TACR2 gene, functions as a receptor for the tachykinin neuropeptide substance K (neurokinin A). This receptor is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system, playing crucial roles in neuronal signaling pathways . The receptor exhibits a specific binding affinity profile with the rank order: substance K > neuromedin-K > substance P . This hierarchical binding profile determines the specificity of receptor activation and subsequent downstream signaling events.

Understanding TACR2 function requires consideration of its molecular characteristics and physiological context. While extensively studied in humans, TACR2 is conserved across species including dogs, facilitating comparative studies that elucidate both conserved and species-specific signaling mechanisms. The receptor participates in numerous physiological processes including smooth muscle contraction, inflammation, and nociception, making it a valuable target for both basic research and therapeutic development.

How does TACR2 differ across species?

Research tools exist for studying TACR2 across multiple species, including recombinant proteins for human, dog, rabbit, mouse, and bovine variants . These resources enable direct comparison of receptor properties and identification of species-specific differences. When designing cross-species experiments, researchers should account for these differences in experimental design and data interpretation, especially when extrapolating findings from one species to another.

The available expression systems for different species' TACR2 variants also provide research opportunities to compare post-translational modifications and tertiary structures that may affect receptor function across evolutionary lineages.

What expression systems are available for producing Recombinant Dog TACR2?

Multiple expression systems have been developed for producing Recombinant Dog Substance-K receptor (TACR2), each offering advantages for specific research applications:

  • E. coli expression system: Provides high yield production of recombinant dog TACR2 in an in vitro system, ideal for applications requiring substantial protein quantities .

  • Yeast expression system: Offers eukaryotic post-translational modifications while maintaining relatively high yield, suitable for studies requiring properly folded protein with some post-translational modifications .

  • Baculovirus expression system: Utilizes insect cells for expression, providing more complex eukaryotic modifications than yeast systems .

  • Mammalian cell expression system: Delivers the most physiologically relevant post-translational modifications and protein folding, especially important for functional studies and antibody development .

  • In Vivo Biotinylation in E. coli: Produces biotinylated receptor proteins, facilitating detection and immobilization for specialized applications such as protein interaction studies .

The expression system selection should align with specific experimental requirements, considering factors such as required protein yield, post-translational modifications, functional activity, and downstream applications.

What are the standard validation methods for Recombinant Dog TACR2?

Validation of Recombinant Dog TACR2 typically employs multiple complementary approaches to confirm identity, purity, and functionality:

Western blotting represents a primary validation method using specific antibodies against TACR2, with expected molecular weight verification providing initial confirmation of protein expression . Commercial antibodies have been validated for TACR2 detection with recommended dilutions of 1:500-1:1000 for optimal results .

For functional validation, receptor binding assays demonstrate specific binding to neurokinin A (substance K) following the expected affinity hierarchy: substance K > neuromedin-K > substance P . Calcium mobilization assays can verify signal transduction capabilities, as TACR2 activation triggers phosphatidylinositol-calcium second messenger systems .

Mass spectrometry provides definitive verification of protein identity and can detect post-translational modifications that may affect receptor function. Surface plasmon resonance (SPR) or microscale thermophoresis (MST) can quantitatively assess binding kinetics with tachykinin ligands, providing direct functional validation.

When validating recombinant TACR2 from different expression systems, researchers should account for system-specific factors that may affect receptor characteristics, particularly when comparing E. coli-derived protein with mammalian cell-expressed variants.

How do different expression systems affect the functionality of Recombinant Dog TACR2?

The expression system selection significantly impacts Recombinant Dog TACR2 functionality through multiple mechanisms affecting protein structure and activity. Each system presents distinct advantages and limitations for research applications:

E. coli expression systems typically yield high protein quantities but lack eukaryotic post-translational modification machinery. For Dog TACR2, this frequently results in inclusion body formation requiring refolding protocols that may impact tertiary structure . While suitable for applications requiring primary sequence integrity (epitope mapping, antibody production), E. coli-expressed receptors often exhibit compromised ligand binding properties.

Yeast and baculovirus systems offer intermediate solutions with some eukaryotic post-translational modifications. Comparative studies reveal these systems produce Dog TACR2 with improved folding and partial glycosylation patterns, enhancing solubility and limited functional activity . These systems prove valuable for structural studies and preliminary functional assessments.

Mammalian expression systems provide the most physiologically relevant environment for Dog TACR2 production. These systems reproduce native glycosylation patterns, disulfide bond formation, and membrane insertion processes critical for proper receptor function . For studies examining G-protein coupling, signal transduction, or ligand binding kinetics, mammalian-expressed Dog TACR2 represents the optimal choice despite lower yields.

The expression system selection should be guided by specific experimental requirements, with strategic consideration of the functional properties most critical to the research question.

What are the structural and functional differences between dog TACR2 and human TACR2?

Sequence alignment studies demonstrate approximately 85-90% amino acid identity between canine and human TACR2, with most variations occurring in the extracellular N-terminus and intracellular loops. These regions critically influence ligand binding specificity and G-protein coupling efficiency, potentially resulting in species-specific pharmacological responses.

Functional differences manifest primarily in receptor pharmacology profiles. While both receptors maintain the same general binding hierarchy (substance K > neuromedin-K > substance P), the absolute binding affinities and signaling kinetics show measurable species-specific variations . These differences particularly impact antagonist binding, with several synthetic antagonists displaying species-selective potency profiles.

The divergent pharmacological profiles necessitate careful experimental design when using dog models for human-targeted therapeutic development. Researchers should conduct parallel assays with both species' receptors when evaluating novel compounds, particularly during early pharmacological characterization.

For structural studies, these differences provide valuable insights into structure-function relationships through comparative analysis of conserved versus variable receptor domains.

How can Recombinant Dog TACR2 be used in comparative neurobiology studies?

Recombinant Dog TACR2 offers significant value in comparative neurobiology through several methodological approaches:

Cross-species receptor pharmacology studies utilize purified recombinant dog TACR2 alongside receptors from other species (human, mouse, rabbit, etc.) to systematically compare ligand binding profiles, signaling dynamics, and antagonist selectivity . This approach identifies both conserved pharmacological properties and species-specific variations critical for translational research.

Heterologous expression systems expressing recombinant dog TACR2 in neuronal cell lines enable investigation of receptor trafficking, localization patterns, and signaling cascades under controlled conditions. When compared with similar systems expressing human receptors, these models reveal fundamental differences in receptor regulation and function.

Chimeric receptor approaches strategically combine domains from dog and human TACR2 to identify specific regions responsible for species-selective pharmacological properties. This methodology has successfully mapped binding domains for several tachykinin receptor antagonists, revealing structure-function relationships impossible to determine through single-species studies.

Evolutionary neurobiology investigations leverage dog TACR2 as a representative canid receptor, positioning it within broader evolutionary studies of tachykinin signaling systems across mammals. This approach has revealed selective pressures on specific receptor domains, correlating with species-specific physiological adaptations.

These comparative approaches collectively enhance our understanding of both fundamental tachykinin biology and species-specific signaling mechanisms, with direct implications for drug development and the appropriate selection of animal models.

What signaling pathways are associated with TACR2 activation in canine models?

TACR2 activation in canine models initiates complex signaling cascades with multiple downstream effectors. Current research has characterized several key pathways:

The primary signaling mechanism involves Gq protein coupling, leading to phospholipase C activation and subsequent generation of inositol trisphosphate (IP3) and diacylglycerol (DAG). This triggers calcium release from intracellular stores and activates protein kinase C (PKC) . Calcium imaging studies in dog-derived cell lines expressing recombinant TACR2 confirm robust calcium mobilization following neurokinin A stimulation, with distinct kinetic profiles compared to TACR1 or TACR3 activation.

Secondary signaling occurs through β-arrestin recruitment, leading to receptor internalization and activation of MAP kinase pathways. Evidence suggests dog TACR2 exhibits distinct β-arrestin coupling efficiency compared to human TACR2, potentially affecting signal duration and desensitization kinetics.

The table below summarizes major signaling pathways activated by dog TACR2:

PathwayKey MediatorsCellular ResponseDetection Methods
Gq/PLC/IP3Phospholipase C, IP3, DAGCalcium mobilization, PKC activationCalcium imaging, IP3 assays
β-arrestinβ-arrestin 1/2, GRKsReceptor internalization, ERK1/2 activationInternalization assays, phospho-ERK detection
MAPKERK1/2, p38, JNKGene transcription, cell proliferationPhospho-specific antibodies, reporter assays
Rho/ROCKRhoA, ROCKCytoskeletal reorganizationStress fiber formation, migration assays

Understanding these signaling mechanisms provides crucial context for interpreting experimental results and developing targeted interventions in canine models.

What are the optimal conditions for handling and storing Recombinant Dog TACR2?

Maintaining optimal conditions for Recombinant Dog TACR2 handling and storage is essential for preserving structural integrity and functional activity. Based on established protocols for similar receptor proteins, the following guidelines are recommended:

Storage temperature significantly impacts protein stability. For short-term use (1-2 weeks), refrigeration at 2-8°C is appropriate for most research applications . For longer-term storage, maintain protein at -20°C, avoiding repeated freeze-thaw cycles that compromise structural integrity and binding capacity . For extended archival storage (>6 months), -80°C is recommended.

Buffer composition critically influences stability. Recombinant TACR2 typically demonstrates optimal stability in phosphate or Tris buffers (pH 7.2-7.6) supplemented with 10-15% glycerol as a cryoprotectant. For transmembrane proteins like TACR2, inclusion of non-ionic detergents (0.1% DDM or 0.5% CHAPS) maintains solubility while preserving native conformations.

Aliquoting strategy should minimize freeze-thaw cycles. Upon initial receipt, divide the protein into single-use aliquots before freezing, as repeated temperature fluctuations significantly accelerate functional degradation . Document preparation date, concentration, and number of freeze-thaw cycles for each aliquot.

Working concentrations should be established through titration experiments for each specific application. For binding assays, typical working concentrations range from 10-100 ng/mL, while functional assays may require 50-250 ng/mL depending on the detection system sensitivity.

These handling parameters ensure consistent experimental results and maximize the utility of recombinant receptor preparations across diverse research applications.

How can I validate the activity of Recombinant Dog TACR2 in my experimental system?

Validating Recombinant Dog TACR2 activity requires a multi-parameter approach targeting both structural integrity and functional capabilities:

Binding assays represent the gold standard for functional validation. Competitive binding assays using radiolabeled or fluorescently-tagged neurokinin A can directly assess receptor-ligand interactions. Successful validation demonstrates binding with the expected affinity hierarchy (substance K > neuromedin-K > substance P) and appropriate Kd values (typically in the nanomolar range) .

Calcium mobilization assays provide functional validation in cellular systems. When expressed in appropriate host cells, activated TACR2 stimulates Gq-mediated calcium release detectable through fluorescent calcium indicators (Fluo-4, Fura-2) . Valid receptor preparations demonstrate concentration-dependent calcium responses with expected EC50 values for neurokinin A stimulation.

Western blot validation confirms protein integrity, molecular weight, and epitope preservation using TACR2-specific antibodies. Several validated antibodies are available with recommended working dilutions between 1:500-1:1000 . Multiple antibodies targeting different epitopes can provide complementary validation data.

Comparative controls should include:

  • Positive control (commercially validated TACR2)

  • Negative control (non-transfected cells/buffer only)

  • Specificity control (cells expressing related receptors TACR1/TACR3)

Validation experiments should systematically document receptor concentration, ligand concentration ranges, assay conditions, and quantitative response parameters. This comprehensive approach ensures experimental rigor and reproducibility when working with recombinant receptor preparations.

What are the recommended protocols for studying TACR2 signaling in canine cell cultures?

Investigating TACR2 signaling in canine cell cultures requires optimized protocols addressing multiple aspects of receptor biology:

Cell system selection critically impacts experimental outcomes. While primary canine cells provide the most physiologically relevant environment, immortalized cell lines offer greater experimental consistency. The MDCK (Madin-Darby Canine Kidney) cell line represents a validated model for TACR2 expression studies, maintaining endogenous G-protein coupling machinery while accepting exogenous receptor expression. Alternatively, heterologous systems (HEK293, CHO) transfected with canine TACR2 provide cleaner backgrounds for mechanistic studies.

Transfection optimization for canine TACR2 typically yields highest efficiency using lipid-based reagents (Lipofectamine 3000, FuGENE HD) with 48-72 hour expression periods before experimentation. Stable cell line generation through antibiotic selection provides more consistent receptor expression for extensive experimental series.

Signaling detection protocols should target multiple pathway components:

  • Calcium signaling: Load cells with Fluo-4/AM (3-5 µM, 30 minutes, 37°C) in serum-free media, then measure fluorescence changes (excitation 488 nm, emission 516 nm) following neurokinin A stimulation. Include ionomycin (1-2 µM) as positive control.

  • IP3 production: Use competitive ELISA-based IP3 quantification kits with cell lysates collected 15-45 seconds after stimulation (peak IP3 production window).

  • ERK1/2 activation: Detect phosphorylated ERK1/2 via Western blot using phospho-specific antibodies, with optimal detection 5-10 minutes post-stimulation.

Pharmacological validation should include:

  • Dose-response studies with neurokinin A (0.1 nM-1 µM range)

  • Competitive antagonist studies using selective TACR2 antagonists (MEN10376, GR94800)

  • Specificity controls with TACR1-selective (RP67580) and TACR3-selective (osanetant) antagonists

These protocols establish a comprehensive experimental framework for investigating TACR2 signaling in canine cellular models.

How can I design experiments to study TACR2-mediated calcium signaling in dog cells?

Designing robust experiments for TACR2-mediated calcium signaling requires careful consideration of technical parameters and appropriate controls:

Experimental design strategy:

  • Establish baseline calcium levels in resting cells

  • Apply neurokinin A in concentration-dependent manner (0.1 nM - 1 µM range)

  • Quantify peak calcium response and area-under-curve

  • Perform antagonist studies with selective TACR2 blockers

  • Examine downstream signaling through pharmacological inhibitors

Technical considerations that significantly impact experimental outcomes include:

Cell preparation protocols should standardize cell density (typically 50,000-75,000 cells/well in 96-well format), serum starvation periods (4-6 hours pre-experiment), and calcium indicator loading conditions (3-5 µM Fluo-4/AM, 30 minutes, 37°C with 0.02% Pluronic F-127 to enhance loading efficiency) .

Instrument parameters for fluorescence plate readers should optimize excitation (488 nm) and emission (516 nm) settings with appropriate gain adjustments. For microscopy-based studies, acquisition rate (typically 1 frame/second) must balance temporal resolution against photobleaching risks.

Data analysis approaches should incorporate:

  • Background subtraction and normalization (F/F0 or ΔF/F0)

  • Area-under-curve calculations for total calcium response

  • EC50 determinations from concentration-response curves

  • Statistical comparison methods appropriate for repeated measures data

The following comprehensive control set enhances experimental rigor:

  • Vehicle control (buffer only)

  • Positive control (ionomycin, 1-2 µM)

  • Receptor specificity control (TACR1/TACR3-selective agonists)

  • Signaling pathway control (Gq inhibitor YM-254890)

  • Calcium source control (BAPTA-AM for internal calcium, EGTA for external calcium)

This experimental framework enables robust characterization of TACR2-mediated calcium signaling while establishing mechanistic insights into receptor function in canine cellular systems.

How do I address inconsistent results when working with Recombinant Dog TACR2?

Inconsistent results with Recombinant Dog TACR2 typically stem from specific methodological variables that can be systematically addressed:

Protein quality variations frequently underlie experimental inconsistency. Implementing rigorous quality control prior to experiments can identify compromised receptor preparations. Assess protein integrity via SDS-PAGE, verify binding capacity through pilot binding assays, and confirm activity through small-scale functional tests before conducting full experimental series .

Expression system-dependent effects create significant variability. E. coli-expressed TACR2 may exhibit incomplete folding and lack post-translational modifications, while mammalian-expressed receptor more closely resembles native protein . Document the expression system for each preparation and avoid comparing results across different systems without appropriate calibration.

Receptor desensitization phenomena can cause time-dependent response variations. Tachykinin receptors undergo rapid desensitization through phosphorylation and internalization mechanisms. For consistent results, standardize pre-incubation times, agonist exposure durations, and recovery periods between stimulations. Consider implementing "pulse-chase" protocols for repeated measures designs.

Technical troubleshooting checklist:

ProblemPossible CausesSolutions
No detectable bindingDenatured receptor, Improper buffer conditionsVerify protein integrity, Optimize buffer composition, Test different detection methods
Weak signal responseInsufficient receptor concentration, Compromised signaling componentsIncrease protein concentration, Verify cell system components with positive controls
High backgroundNon-specific binding, Endogenous receptor expressionInclude blocking agents, Use knockout/knockdown controls
Variable response amplitudeReceptor degradation, Cell passage number effectsPrepare fresh aliquots, Standardize cell culture conditions

Implementing a systematic laboratory notebook system documenting all experimental variables (protein lot, storage time, buffer conditions, cell passage) facilitates troubleshooting by identifying correlation patterns between experimental conditions and outcomes.

What controls should be included in experiments using Recombinant Dog TACR2?

Robust experimental design for Recombinant Dog TACR2 studies requires comprehensive controls addressing multiple aspects of receptor biology and experimental methodology:

Receptor-specific controls verify the specificity of observed responses:

  • Negative controls: Buffer-only conditions and non-transfected cells establish baseline signals and identify non-receptor-mediated effects.

  • Competitive binding controls: Excess unlabeled ligand (100-1000× concentration) demonstrates binding specificity by competing with labeled probes.

  • Cross-receptor controls: Selective agonists/antagonists for related receptors (TACR1, TACR3) confirm signal specificity and assess potential cross-reactivity .

Methodological controls validate experimental procedures:

  • System validation controls: Well-characterized receptor systems (β2-adrenergic receptor) with established pharmacology verify assay functionality.

  • Positive signal controls: Direct activators of downstream pathways (GTPγS for G-protein activation, ionomycin for calcium signaling) confirm detector system functionality.

  • Expression level controls: Standardized receptor quantification (surface ELISA, radioligand binding) enables normalization across experiments.

Pharmacological validation controls enhance mechanistic interpretations:

  • Dose-response controls: Complete concentration-response curves (typically 8-10 concentrations spanning 4 log units) establish EC50/IC50 values and efficacy parameters.

  • Signaling pathway inhibitors: Selective blockers targeting specific pathway components (Gq inhibitors, PLC inhibitors, calcium chelators) delineate signaling mechanisms.

  • Kinetic controls: Time-course measurements capturing response dynamics identify optimal measurement windows and reveal desensitization profiles.

The comprehensive control framework ensures experimental rigor, facilitates troubleshooting, and enables confident interpretation of results when working with recombinant receptor systems.

How can I differentiate between TACR1, TACR2, and TACR3 activities in my experiments?

Differentiating between tachykinin receptor subtypes requires strategic application of pharmacological tools, molecular approaches, and functional assays:

Selective pharmacological agents provide the most direct approach for distinguishing receptor subtypes:

ReceptorSelective AgonistsSelective AntagonistsWorking Concentrations
TACR1[Sar9,Met(O2)11]-SP, GR73632RP67580, CP-96,345Agonists: 1-100 nM Antagonists: 10-500 nM
TACR2[β-Ala8]-NKA, GR64349GR94800, MEN10376Agonists: 1-100 nM Antagonists: 10-500 nM
TACR3senktide, [MePhe7]-NKBosanetant, talnetantAgonists: 0.1-50 nM Antagonists: 1-100 nM

When applying these tools, conduct complete concentration-response analyses rather than single-concentration experiments to identify potential off-target effects at higher concentrations.

Molecular approaches offer complementary differentiation strategies:

  • Receptor-specific antibodies: Western blotting and immunocytochemistry with validated antibodies (multiple commercial sources available with specified dilutions) .

  • RT-PCR/qPCR: Transcript-specific primers distinguish expression patterns of different receptor subtypes.

  • siRNA knockdown: Subtype-specific silencing creates defined systems with selective receptor suppression.

Functional discrimination utilizes distinct signaling properties:

  • Calcium response kinetics: TACR1 typically produces rapid, transient responses; TACR2 generates more sustained elevations; TACR3 exhibits intermediate kinetics.

  • Internalization dynamics: Receptor subtypes display different internalization rates and trafficking patterns following agonist exposure.

  • G-protein coupling profiles: TACR1 and TACR2 predominantly couple to Gq/11, while TACR3 exhibits additional G12/13 coupling capabilities.

This multi-parameter approach enables confident discrimination between tachykinin receptor subtypes in complex experimental systems, facilitating accurate interpretation of observed biological responses.

What are common pitfalls in interpreting data from TACR2 receptor binding assays?

Interpreting TACR2 receptor binding assay data presents several potential pitfalls requiring careful consideration:

Non-specific binding contributions frequently confound interpretation, particularly when working with hydrophobic ligands or membrane preparations. Best practices include parallel measurements with excess unlabeled competitor (typically 100-1000× concentration) to determine specific binding component. Non-specific binding should ideally represent <30% of total binding signal for reliable analysis.

Ligand depletion effects occur when bound ligand represents >10% of total ligand concentration, violating assumptions in standard binding equations. This commonly manifests as artificially shallowed binding curves and underestimated binding affinities. Free ligand concentration calculations or experimental dilution series can address this issue.

Association state equilibrium problems arise when insufficient incubation time prevents reaching binding equilibrium. TACR2 typically requires 60-90 minutes to reach equilibrium at room temperature, with longer times needed at 4°C. Kinetic binding experiments establishing association rates inform appropriate incubation periods.

Heterogeneous binding site populations in recombinant preparations can result from:

  • Multiple receptor conformations (active/inactive states)

  • Differential post-translational modifications

  • Oligomerization with endogenous receptors

  • Proteolytic degradation creating truncated receptors

These heterogeneous populations manifest as shallow or biphasic binding curves. Analysis with two-site binding models may reveal distinct binding components.

Data transformation distortions occur when using linearized plots (Scatchard/Rosenthal) rather than direct non-linear regression. While historically common, linearization mathematically distorts error distribution. Modern analysis should employ direct non-linear fitting of binding isotherms using appropriate equations (one-site, two-site, or allosteric models).

Awareness of these potential pitfalls and implementation of appropriate experimental and analytical controls ensures accurate interpretation of binding data for recombinant TACR2 preparations.

How is Recombinant Dog TACR2 being used in comparative neuropharmacological studies?

Recombinant Dog TACR2 has emerged as a valuable tool in comparative neuropharmacology, facilitating several innovative research approaches:

Species-selective pharmacology screening employs parallel testing of compounds against human and dog TACR2 preparations to identify species-specific binding profiles early in drug development. This approach has successfully identified several antagonists with species-selective profiles, providing valuable tools for proof-of-concept studies and reducing translational failures in preclinical testing. Recent experimental paradigms incorporate high-throughput screening platforms using canine receptor preparations alongside human targets.

Structural determinants of binding investigations utilize comparative analysis of dog and human TACR2 to identify critical regions determining ligand selectivity. Site-directed mutagenesis studies guided by sequence alignments have revealed specific extracellular loop residues contributing to species-selective antagonist binding. These findings inform structure-based drug design efforts targeting conserved binding pockets to develop compounds with cross-species activity.

Signal transduction comparison studies examine species-specific differences in G-protein coupling efficiency, β-arrestin recruitment, and receptor internalization patterns. Recent investigations have identified differences in phosphorylation sites between dog and human TACR2 that influence desensitization kinetics, with implications for therapeutic dosing regimens in different species.

Evolutionary neuropharmacology approaches position dog TACR2 within broader phylogenetic analyses of tachykinin receptor evolution. Molecular clock analyses incorporating canine receptors have revealed patterns of evolutionary constraint on ligand binding domains while showing accelerated evolution in intracellular regions influencing signaling pathway coupling.

These comparative approaches collectively enhance our understanding of both fundamental tachykinin signaling mechanisms and species-specific considerations critical for translational research.

What recent advances have been made in understanding species-specific differences in tachykinin systems?

Recent advances in comparative tachykinin biology have revealed nuanced species-specific differences with significant implications for both basic research and therapeutic development:

Receptor distribution mapping using species-specific antibodies and mRNA probes has identified divergent expression patterns of TACR2 across species. While human and dog TACR2 share broad distribution patterns in gastrointestinal tissues, subtle differences exist in neuronal populations of the enteric nervous system . Notably, canine TACR2 shows more widespread expression in pulmonary tissues compared to the human receptor, potentially reflecting species-specific roles in respiratory physiology.

Pharmacogenomic analyses have identified single nucleotide polymorphisms (SNPs) in canine TACR2 that parallel clinically relevant human polymorphisms. These natural variants provide valuable models for understanding receptor polymorphism effects on drug response variability. Breed-specific TACR2 polymorphisms correlate with differential responses to tachykinin-targeted compounds in veterinary applications.

Signaling pathway divergence has been documented through phosphoproteomic approaches comparing downstream effectors activated by orthologous receptors. While the canonical Gq-calcium pathway remains conserved, species-specific differences emerge in secondary signaling cascades, particularly in MAP kinase activation patterns and scaffold protein recruitment profiles .

Developmental expression profiles of tachykinin receptors reveal species-specific temporal patterns. Canine TACR2 expression peaks earlier in neurodevelopment compared to the human ortholog, with potentially important implications for understanding developmental disorders and early-life therapeutic interventions.

These emerging findings highlight the importance of species-informed approaches when investigating tachykinin biology and developing therapeutic strategies targeting these receptor systems.

How can insights from canine TACR2 studies be translated to human health research?

Translating insights from canine TACR2 studies to human health research involves several strategic approaches that leverage the comparative value of dog models:

Translational pharmacology frameworks build bridges between canine studies and human applications through parallel assessment of compound pharmacology. Systematic characterization of novel compounds against both dog and human TACR2 identifies translational gaps early in development . Binding affinity ratios (human:dog) provide predictive metrics for cross-species activity, with compounds showing ratios between 0.5-2.0 typically demonstrating the most reliable translational profiles.

Spontaneous disease models in companion animals offer unique translational opportunities. Several canine conditions involving neurogenic inflammation and gastrointestinal hypermotility involve TACR2 signaling, paralleling human disorders. These naturally occurring models provide validation platforms with greater predictive value than induced models, particularly for chronic therapeutic interventions targeting tachykinin systems.

Comparative pathway analysis identifies both conserved and divergent signaling mechanisms between species. Recent phosphoproteomic studies have mapped the TACR2 "signalome" across species, revealing core conserved pathways suitable for therapeutic targeting alongside species-specific components that require careful translational consideration .

Therapeutic prediction algorithms incorporating machine learning approaches now integrate species-specific receptor pharmacology data to predict human responses based on canine studies. These computational tools analyze binding kinetics, signaling outputs, and physiological responses across species to generate translational confidence scores for candidate compounds.

The table below summarizes key considerations for translational studies:

AspectConserved FeaturesSpecies DifferencesTranslational Implications
Ligand BindingCore binding pocket structureExtracellular loop variationsModify compound hydrophilic regions for cross-species activity
SignalingGq-calcium pathwaySecondary pathway coupling efficiencyFocus on conserved pathway biomarkers for translational studies
ExpressionMajor organ systemsRegion-specific expression levelsConsider tissue-specific translation when predicting drug effects
Therapeutic ResponseAntagonist mechanism of actionPotency and side effect profilesAdjust dosing based on species-specific pharmacodynamics

These translational approaches maximize the predictive value of canine studies while acknowledging species-specific considerations critical for successful human applications.

What are emerging techniques for studying TACR2 function across species?

Emerging technological approaches are revolutionizing comparative TACR2 research, enabling unprecedented insights into receptor function across species:

CRISPR-based genome editing now facilitates precise "humanization" of canine TACR2, replacing species-specific domains with human sequences to create chimeric receptors in cell models and potentially in vivo. This approach directly tests the functional significance of species-specific sequences while creating improved translational models for pharmacological studies .

Advanced structural biology techniques, including cryo-electron microscopy and X-ray crystallography, are being applied to TACR2 from multiple species. These studies reveal atomic-level details of ligand binding pockets and conformational states, identifying both conserved structural elements and species-specific features. Recent advances in nanobody-stabilized receptor preparations have overcome previous technical limitations in tachykinin receptor structural biology.

Single-cell transcriptomics enables high-resolution mapping of TACR2 expression across tissues and species, revealing previously unrecognized cell type-specific expression patterns. Comparative single-cell studies have identified conserved "tachykinin-responsive cell signatures" across species while highlighting species-specific cellular contexts of receptor expression.

Biosensor technologies employing FRET-based approaches provide real-time visualization of TACR2 signaling dynamics in living cells. These techniques reveal species-specific differences in:

  • Receptor conformational changes following ligand binding

  • G-protein coupling kinetics and efficiency

  • Spatial organization of signaling components

  • Receptor trafficking patterns following activation

AI-driven pharmacological prediction leverages machine learning algorithms trained on cross-species pharmacological datasets to predict binding properties and functional outcomes for novel compounds. These computational approaches accelerate translation by identifying compounds likely to exhibit consistent pharmacology across species early in development.

These emerging techniques collectively enhance our ability to understand TACR2 biology across species boundaries, accelerating both fundamental research and therapeutic development targeting tachykinin systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.