Recombinant Dog Thyrotropin receptor (TSHR)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

The TSHR belongs to the G protein-coupled receptor (GPCR) family, characterized by a large extracellular domain for TSH binding and a transmembrane domain for signal transduction . Key functional aspects include:

  • Activation mechanism: TSH binding induces conformational changes, activating adenylate cyclase via Gαs proteins to increase cAMP production .

  • Iodide regulation: Prolonged TSHR activation (>24 hours) upregulates sodium-iodide symporter (NIS) expression, enhancing iodide uptake and organification .

Diagnostic Applications in Canine Medicine

Recombinant human TSH (rhTSH) is used to assess thyroid reserve capacity and diagnose hypothyroidism in dogs:

Key Protocols and Findings

ParameterValue/OutcomeSource
rhTSH dose75–100 μg IV
Post-TSH T4 cutoff<1.3 μg/dL (hypothyroid)
Diagnostic accuracyAUC-ROC = 0.99 for post-TSH T4 levels
  • Breed-specific considerations: Greyhounds, Scottish Deerhounds, and Alaskan sled dogs exhibit naturally lower baseline T4 levels, necessitating breed-adjusted reference intervals .

Therapeutic Use in Thyroid Carcinoma

rhTSH pretreatment enhances radioiodine (¹³¹I) uptake in canine thyroid tumors, aligning with the ALARA radiation safety principle :

Tumor Radioactive Iodine Uptake (RAIU) Outcomes

Time Post-rhTSHMean RAIU IncreaseSignificance (P-value)
8 hours4.54%0.05 (NS)
24 hours8.85%0.03
  • Dose optimization: Higher bodyweight correlates with greater 8h-RAIU improvement (slope = 0.44%/kg, P = 0.03) .

  • Thyroid hormone response: Serum total T4 (TT4) peaks at 6–24 hours post-rhTSH (median Δ = 35.86 nmol/L) .

Research Insights from TSHR Knockout Models

TSHR-KO mice provide critical insights into receptor function :

  • Phenotype: Severe hypothyroidism (undetectable T4, elevated TSH) and absent NIS expression .

  • Compensatory mechanisms: Forskolin (adenylate cyclase agonist) restores iodide organification in TSHR-KO thyroids, confirming cAMP's role in NIS regulation .

Challenges and Future Directions

  • Variable response: Hyperthyroid dogs show reduced 24h-RAIU post-rhTSH (P = 0.02) .

  • Long-term safety: No adverse effects reported in clinical trials , but immunogenicity studies in dogs remain limited.

Recombinant dog TSHR tools have revolutionized thyroid disease management in veterinary medicine, offering precise diagnostic thresholds and enhanced therapeutic efficacy. Ongoing research aims to refine dosing protocols and explore autoimmune implications linked to TSHR antibodies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
TSHR; Thyrotropin receptor; Thyroid-stimulating hormone receptor; TSH-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-764
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
GKGCPSPPCECHQEDDFRVTCKDIHRIPTLPPSTQTLKFIETQLKTIPSRAFSNLPNISR IYLSIDATLQRLESHSFYNLSKMTHIEIRNTRSLTSIDPDALKELPLLKFLGIFNTGLGV FPDVTKVYSTDVFFILEITDNPYMASIPANAFQGLCNETLTLKLYNNGFTSIQGHAFNGT KLDAVYLNKNKYLSAIDKDAFGGVYSGPTLLDVSYTSVTALPSKGLEHLKELIARNTWTL KKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLMCNESSIRSLRQRKSVNTLNG PFDQEYEEYLGDSHAGYKDNSQFQDTDSNSHYYVFFEEQEDEILGFGQELKNPQEETLQA FDSHYDYTVCGGNEDMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALLGNVFVLIVLL TSHYKLTVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQTGPGCNTAGFF TVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHAYAIMVGGWVCCFLLALLPLVGI SSYAKVSICLPMDTETPLALAYIILVLLLNIVAFIIVCSCYVKIYITVRNPQYNPGDKDT KIAKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSKILLVLFYPLNSCANPFLYAI FTKAFQRDVFILLSKFGICKRQAQAYRGQRVSPKNSAGIQIQKVTRDMRQSLPNMQDEYE LLENSHLTPNKQGQISKEYNQTVL
Uniprot No.

Target Background

Function

The recombinant dog thyrotropin receptor (TSHR) is a receptor for thyroid-stimulating hormone (TSH), also known as thyrotropin. It also acts as a receptor for the heterodimeric glycoprotein hormone (GPHA2:GPHB5), or thyrostimulin. TSHR activity is mediated by G proteins that activate adenylate cyclase. This receptor plays a crucial role in regulating thyroid cell metabolism.

Database Links
Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.

Q&A

What is canine Thyrotropin receptor (TSHR) and how does it differ from human TSHR?

Canine Thyrotropin receptor (TSHR) is a G protein-coupled receptor expressed primarily on thyroid follicular cells that serves as the binding site for thyroid stimulating hormone (TSH). When activated, it regulates thyroid gland function, including growth, differentiation, and production of thyroid hormones.

While canine TSHR shares significant homology with human TSHR, there are species-specific differences in the extracellular domain that affect ligand binding properties. Despite these differences, research demonstrates that human recombinant TSH (rhTSH) effectively binds to and activates canine TSHR. This cross-species reactivity enables the use of rhTSH in canine patients, as evidenced by studies showing that rhTSH administration increases radioiodine uptake in canine thyroid tumors by a median factor of 2.5 at 24 hours post-administration .

How is recombinant dog TSHR used to study thyroid hormone regulation?

Recombinant dog TSHR provides a valuable tool for studying the molecular mechanisms of thyroid hormone regulation in canines. The receptor plays a crucial role in iodine uptake and thyroid hormone production through several mechanisms:

  • Regulation of sodium-iodide symporter (NIS): TSH binding to TSHR activates signaling pathways that upregulate NIS expression and function. Studies show that "TSH is responsible for uptake of (radioactive) iodine in the thyroid follicular cell through activation of the TSH receptor (TSHR) in which prolonged activation (>24 hours) stimulates the expression and function of the NIS and, subsequently, increases iodide uptake and organification" .

  • Species-specific responses: Research demonstrates significant differences in thyroid hormone levels across dog breeds, suggesting breed-specific variations in TSHR function . Understanding these variations is essential for accurate interpretation of thyroid function tests.

  • Radioiodine uptake enhancement: In research settings, TSHR activation via rhTSH has been shown to significantly increase radioiodine uptake in canine thyroid tumors (mean difference = 8.85% at 24 hours), making this approach valuable for both diagnostic and therapeutic nuclear medicine applications .

What are the primary applications of recombinant dog TSHR in veterinary research?

Recombinant dog TSHR has several important applications in veterinary research:

  • Thyroid cancer diagnosis and treatment: TSHR serves as a molecular target for innovative diagnostic approaches. Studies have demonstrated that "differentiated thyroid cancer (DTC) cells may lose NIS expression and iodine uptake, but usually express TSH receptors" . This property enables the development of TSHR-targeted radiopharmaceuticals for imaging thyroid cancer, even when conventional radioiodine imaging is ineffective.

  • Radioiodine therapy optimization: Research shows that TSHR stimulation with rhTSH "could optimize 131I treatment in dogs with TC by increasing tumor RAIU and thus 131I treatment efficacy" . This approach allows for more efficient treatment while adhering to the "as low as reasonably achievable" (ALARA) radiation safety principle.

  • Breed-specific thyroid function assessment: Studies have identified significant variations in thyroid hormone levels across dog breeds , necessitating breed-specific reference intervals to prevent misdiagnosis of thyroid disorders.

  • TSH stimulation testing: Recombinant TSHR and TSH analogs have applications in diagnostic testing, with research showing that "rhTSH could be a good substitute for bovine TSH, when used by the intravenous route, for the TSH stimulation test in dogs" .

What are the optimal protocols for evaluating TSHR-mediated radioiodine uptake in canine thyroid studies?

Research indicates several methodological considerations for evaluating TSHR-mediated radioiodine uptake in canine thyroid studies:

Study design parameters:

  • Crossover design: Studies should employ a randomized crossover design with adequate washout periods (7-14 days) between measurements to minimize carryover effects, as demonstrated in recent research .

  • Timing of measurements: Radioiodine uptake should be measured at both early (8 hours) and delayed (24 hours) timepoints after isotope administration to capture the full dynamics of uptake. Research shows significantly higher uptake at 24 hours with rhTSH stimulation (mean difference = 8.85%, p = 0.03) .

rhTSH administration protocol:

  • Optimal dosing: A two-dose protocol of 100 μg rhTSH administered 24 and 12 hours before radioiodine provides optimal stimulation .

  • Route of administration: Intravenous administration is superior to intramuscular or subcutaneous routes, with studies showing significant increases in serum TT4 only with IV administration .

Measurement methodology:

  • Quantitative assessment: Studies should use quantitative region-of-interest analysis to calculate the percentage of administered radioactivity in the thyroid tumor.

  • Background correction: Proper correction for background activity is essential for accurate measurements.

Monitoring parameters:

  • Serum hormone measurements: TT4 and TSH concentrations should be monitored at baseline and at 6, 12, 24, and 48 hours after rhTSH administration to assess hormonal response .

  • Size-adjusted dosing: Research shows that "tumor 8h-RAIU increased significantly with bodyweight (slope = 0.44%/kg)" , suggesting the need for weight-adjusted dosing protocols.

How should researchers design studies to compare efficacy of different TSH receptor ligands?

Based on published research, an optimal study design for comparing TSH receptor ligand efficacy should include:

In vitro evaluation:

AssessmentMethodologyKey Parameters
Binding affinityReceptor binding assaysDissociation constants (Kd): Published studies report Kd of 2.7 nM for 99mTc-TR1401, 0.5 nM for 99mTc-TR1402, and 8.4 nM for 99mTc-Thyrogen
Functional activityCell-based assayscAMP production, iodide uptake stimulation
Structural integrityChromatography, mass spectrometryRetention of biological activity after modification

In vivo evaluation:

  • Study population: Use dogs with spontaneous thyroid pathology rather than induced models. Research indicates that "dogs often develop spontaneous thyroid cancers with histological features very similar to human follicular cancer, and expressing TSHR" .

  • Comparative imaging: Conduct sequential imaging with different ligands in the same subjects with appropriate washout periods. Published studies have successfully compared "99mTc-TR1401 SPECT/CT, 99mTc-TR1402 SPECT/CT, and [18F]FDG PET/CT on different days within 2 weeks" .

  • Quantitative metrics: Calculate tumor-to-background ratios for objective comparison. Research has demonstrated significant differences in T/B ratios: "99mTc-TR1402 provided higher T/B than 99mTc-TR1401 and [18F]FDG (12.9 ± 1.3, 10.2 ± 0.7, and 3.8 ± 0.6, respectively)" .

  • Histological validation: Perform immunohistochemistry for TSHR expression on excised tumors to correlate imaging findings with receptor density .

  • Safety evaluation: Monitor for potential stimulation of tumor growth or hormone release, particularly with high-affinity ligands.

What analytical methods provide the most accurate assessment of canine thyroid function in research settings?

Research into canine thyroid function requires specialized analytical methods to ensure accurate assessment:

Hormone measurement techniques:

  • Chemiluminescent immunoassays: These provide high sensitivity for measuring serum TT4 and TSH concentrations. Studies utilize "commercially available chemiluminescent immunoassay system (IMMULITE 2000 XPi Immunoassay System, Siemens), validated in dogs, using 6.45-43.86 nmol/L and <0.5 ng/mL as reference intervals, respectively" .

  • Breed-specific reference intervals: Research demonstrates significant variations in thyroid hormone levels across breeds. "Healthy Greyhounds were shown to have significantly lower serum T4 and free T4 (FT4) concentrations when compared with non-Greyhounds" . Similar findings are reported for "Scottish Deerhounds, Alaskan sled dogs, Sloughis, and Basenjis" .

Statistical approaches:

  • Mixed models: For repeated measures designs, "a mixed model with dog as random effect, and period and treatment as fixed effects" provides robust analysis .

  • Non-parametric techniques: When normal distribution assumptions are not met, non-parametric methods are preferred for analyzing hormone data .

  • Correlation analysis: "Kendall's tau correlation coefficient" can assess relationships between physiological parameters and response to treatment .

Functional assessment:

  • Radioiodine uptake studies: Quantitative measurement of iodine uptake provides functional assessment of thyroid activity, with research showing significant increases following rhTSH administration .

  • TSH stimulation testing: IV administration of rhTSH (50 μg) provides optimal results for assessing thyroid reserve capacity .

How can recombinant TSHR technology improve diagnosis of canine thyroid cancer?

Recombinant TSHR technology offers several advantages for improving canine thyroid cancer diagnosis:

TSHR-targeted imaging:
Research demonstrates that radiolabeled TSHR ligands can effectively visualize thyroid tumors, even when conventional methods fail. Studies have shown that "in tumor-targeting experiments, a focal uptake was observed in dogs with spontaneous intraglandular thyroid carcinoma, in which TSHR expression was confirmed by immunohistochemistry" .

The development of superagonist rhTSH analogues (TR1401 and TR1402) with higher TSHR binding affinity than standard rhTSH provides enhanced imaging capabilities. Comparative studies show that "99mTc-TR1402 provided higher T/B than 99mTc-TR1401 and [18F]FDG (12.9 ± 1.3, 10.2 ± 0.7, and 3.8 ± 0.6, respectively)" .

Pre-operative staging:
TSHR-targeted imaging offers particular value for pre-operative staging. "One of the main advantages of this approach is the possibility of performing a preliminary scan before the thyroidectomy to identify possible local or distant metastases that lost the capacity to uptake radioiodine, but are still positive to the TSHR" .

Differentiation of tumor types:
Research indicates that "differentiated thyroid cancer (DTC) cells may lose NIS expression and iodine uptake, but usually express TSH receptors" . This makes TSHR-based imaging particularly valuable for detecting dedifferentiated tumors that conventional radioiodine imaging might miss.

Technical considerations:
For optimal clinical applications, radiolabeled TSHR ligands should possess "high specific activity and Kd... as high as possible" to minimize potential biological effects while maximizing imaging quality .

What factors influence TSHR-mediated radioiodine uptake in canine thyroid tumors?

Research has identified several key factors that influence TSHR-mediated radioiodine uptake in canine thyroid tumors:

Physiological factors:

  • Body weight: Studies show "tumor 8h-RAIU increased significantly with bodyweight (slope = 0.44%/kg, standard error [SE] = 0.19%/kg; P = .03)" . This indicates larger dogs may demonstrate greater response to TSHR stimulation.

  • Timing of measurement: Research demonstrates that radioiodine uptake at 24 hours post-stimulation shows greater enhancement with rhTSH than at 8 hours, with "mean difference = 8.85%, 95% CI of [1.56; 16.14]; P = .03" .

  • Hormone dynamics: Following rhTSH administration, "serum TT4 concentration peaked at T24 in 7/9 dogs, and at T6 in 2/9 dogs" , indicating individual variations in response timing.

Tumor characteristics:

  • Receptor expression: The presence and density of TSHR on tumor cells directly influences uptake, as confirmed by "immunohistochemistry for TSHR expression on excised tumors" .

  • Tumor differentiation: Research indicates variation in TSHR expression across differentiation grades, with some tumors maintaining TSHR expression even when losing NIS expression .

Technical factors:

  • rhTSH administration protocol: The timing and route of rhTSH administration significantly impacts efficacy. Studies show that "recombinant human TSH had a higher 8h- and 24h-RAIU compared to control in 11/12 and 9/12 primary thyroid tumors, respectively" when administered using a two-dose protocol (24 and 12 hours before radioiodine).

  • Route of administration: Research demonstrates that intravenous administration provides superior results compared to intramuscular or subcutaneous routes .

How do breed differences affect interpretation of thyroid function tests in canine research?

Research demonstrates significant breed-based variations in thyroid function parameters that must be considered when interpreting thyroid function tests:

Documented breed variations:

  • Small vs. large breeds: "Total thyroxine (T4) concentrations were reported to be greater in 'small' dogs when compared with 'medium or large' breed dogs" .

  • Breed-specific reference ranges: Research shows that "healthy Greyhounds were shown to have significantly lower serum T4 and free T4 (FT4) concentrations when compared with non-Greyhounds" . Similarly, "Scottish Deerhounds, Alaskan sled dogs, Sloughis, and Basenjis all have T4 concentrations that are at, or below, a low limit of the previously established reference range for T4" .

Research implications:

  • Misdiagnosis risk: "Without breed-specific RIs, healthy dogs from these breeds will likely be misdiagnosed as being hypothyroid or equivocal for thyroid health" . This can lead to:

    • Unnecessary additional testing

    • Inappropriate thyroid supplementation

    • Removal from breeding programs

    • Overestimation of hypothyroidism prevalence in certain breeds

  • Body weight correlations: Research shows that "dogs' bodyweight was significantly negative correlated with the AUC of serum TSH (r = −0.704, P = .009)" following rhTSH administration , indicating that smaller dogs may show more pronounced TSH elevation in response to the same dose of rhTSH.

  • Study design considerations: Researchers should:

    • Stratify data by breed when analyzing thyroid parameters

    • Establish and use breed-specific reference intervals

    • Consider breed as a covariate in statistical analyses

    • Match subjects by breed in comparative studies

These findings highlight the critical importance of considering breed-specific variations in both research and clinical settings to prevent misinterpretation of thyroid function test results.

How can structural comparisons between human and canine TSHR inform development of species-specific ligands?

Structural comparisons between human and canine TSHR provide valuable insights for developing species-specific ligands:

Key structural considerations:

DomainResearch FindingsImplications for Ligand Development
Extracellular domainHigh conservation in binding pocket with species-specific differences in peripheral regionsTarget conserved regions for cross-species ligands; species-specific regions for selective targeting
Transmembrane domainsHighly conserved across speciesFocus on extracellular domain for species selectivity
Intracellular loopsVariations affecting G-protein coupling efficiencyMay influence functional response to ligand binding

Research approaches:

  • Binding affinity studies: Comparative binding assays reveal that superagonist TSH analogues demonstrate superior binding to both human and canine TSHR. Studies report dissociation constants "of 2.7 nM for 99mTc-TR1401 and 0.5 nM for 99mTc-TR1402 compared with 99mTc-Thyrogen (Kd = 8.4 nM)" .

  • Functional response mapping: Research indicates species-specific variations in response to TSH stimulation, with dogs showing different patterns of hormone elevation compared to humans following rhTSH administration .

  • Molecular modeling: Computational approaches can identify structural differences between canine and human TSHR to guide rational design of species-selective ligands.

  • Site-directed mutagenesis: Experimental validation of key binding residues through targeted mutations can confirm in silico predictions and refine ligand design.

These approaches support development of both cross-species ligands (for translational research) and species-specific ligands (for selective targeting in research or clinical applications).

What are the molecular mechanisms underlying TSHR-mediated enhancement of radioiodine uptake in thyroid cancer?

Research has elucidated several molecular mechanisms by which TSHR activation enhances radioiodine uptake in thyroid cancer:

Sodium-iodide symporter (NIS) regulation:
The primary mechanism involves upregulation of NIS expression and function. Studies demonstrate that "TSH is responsible for uptake of (radioactive) iodine in the thyroid follicular cell through activation of the TSH receptor (TSHR) in which prolonged activation (>24 hours) stimulates the expression and function of the NIS and, subsequently, increases iodide uptake and organification" .

Signal transduction pathways:
TSHR activation initiates several signaling cascades:

  • cAMP pathway: Primary mechanism for NIS upregulation

  • PI3K/Akt pathway: Influences NIS trafficking to plasma membrane

  • MAPK pathway: Modulates NIS expression and function

Temporal dynamics:
Research indicates that the timing of TSHR stimulation significantly impacts efficacy. Studies show that "tumor RAIU was significantly higher at 24 hours with rhTSH compared to no rhTSH (mean difference = 8.85%, 95% CI of [1.56; 16.14]; P = .03), while this was non-significant at 8 hours" . This suggests that "prolonged activation (>24 hours)" is required for optimal NIS upregulation .

Iodide organification:
Beyond uptake, TSHR activation also enhances iodide organification—the incorporation of iodide into thyroglobulin—through upregulation of thyroid peroxidase and other enzymes in the thyroid hormone synthesis pathway.

Translational implications:
These mechanisms explain why "recombinant human TSH could optimize 131I treatment in dogs with TC by increasing tumor RAIU and thus 131I treatment efficacy" and support the development of optimized protocols for TSH administration prior to radioiodine therapy.

How can researchers optimize recombinant TSHR ligands for diagnostic versus therapeutic applications?

Research indicates several key considerations for optimizing recombinant TSHR ligands for different applications:

Diagnostic applications:

ParameterOptimization StrategyResearch Evidence
Binding affinityMaximize for high-contrast imagingSuperagonist TSH analogues (TR1401/TR1402) show higher binding affinity than standard rhTSH, with TR1402 having the highest affinity (Kd = 0.5 nM)
Specific activityMaximize to reduce required protein doseHigh specific activity (8.3 ± 1.2 MBq/μg) enables injection of "a very low amount of protein (approximately 30 μg)" while achieving high target-to-background ratios
PharmacokineticsBalance blood clearance with tumor uptake time99mTc-TR1402 provides higher tumor-to-background ratios (12.9 ± 1.3) than 99mTc-TR1401 (10.2 ± 0.7) and [18F]FDG (3.8 ± 0.6)
Biological effectsMinimize to prevent stimulation of tumor growthHigh specific activity and affinity allow reduced protein dose, "resulting in a high target-to-background ratio with no biological effects"

Therapeutic applications:

  • Radioiodine uptake enhancement: For optimizing 131I therapy, research shows that:

    • Timing is critical: "tumor RAIU was significantly higher at 24 hours with rhTSH"

    • Administration protocol affects efficacy: two doses (24 and 12 hours pre-radioiodine) provide optimal stimulation

    • Body weight influences response: "tumor 8h-RAIU increased significantly with bodyweight"

  • Direct therapeutic targeting: For TSHR-targeted therapies:

    • High selectivity is essential to minimize off-target effects

    • Coupling to therapeutic radionuclides requires stable conjugation chemistry

    • Internalization properties may need to be optimized depending on the therapeutic payload

Research approaches for optimization:

  • Structure-activity relationship studies: Systematic modification of TSH analogues to enhance desired properties

  • In vivo imaging studies: Comparative evaluation in spontaneous canine thyroid cancer models

  • Dosimetry calculations: Optimizing administered activity based on tumor uptake and retention

  • Safety evaluation: Assessing potential biological effects of high-affinity ligands

How applicable are findings from canine TSHR studies to human thyroid research?

Research demonstrates strong translational relevance of canine TSHR studies to human thyroid research:

Advantages of canine models:

  • Spontaneous disease models: "Dogs often develop spontaneous thyroid cancers with histological features very similar to human follicular cancer, and expressing TSHR" . This provides superior translational value compared to murine models, as "murine models of cancer xenograft are somehow artificial and the lack of an appropriate tumor microenvironment does not always allow us to easily translate results into humans" .

  • TSHR expression patterns: Similar to human thyroid cancer, canine "differentiated thyroid cancer (DTC) cells may lose NIS expression and iodine uptake, but usually express TSH receptors (TSHR)" . This shared characteristic enables parallel development of diagnostic and therapeutic approaches.

  • Response to TSH stimulation: Canine thyroid tissue shows comparable responses to rhTSH as human tissue, with documented increases in radioiodine uptake following stimulation .

Translational applications:

  • Diagnostic imaging: Research with radiolabeled TSH superagonists in dogs directly supports human applications. Studies conclude that "99mTc-TR1402 is a good candidate radiopharmaceutical to be translated in humans to evaluate its contribution as a noninvasive diagnostic tool for pre-operative staging of patients affected by thyroid cancer and their follow-ups" .

  • Radioiodine therapy optimization: Findings demonstrating that "recombinant human TSH could optimize 131I treatment in dogs with TC by increasing tumor RAIU and thus 131I treatment efficacy" have direct implications for similar approaches in human patients.

  • Individual variability considerations: Just as dog breed affects thyroid parameters , human genetic variation similarly influences thyroid function and response to therapy.

What ethical considerations should guide the use of recombinant TSHR technology in veterinary research?

Ethical considerations for using recombinant TSHR technology in veterinary research should address several domains:

Animal welfare:

  • Minimizing invasiveness: Leverage non-invasive imaging techniques such as SPECT/CT with 99mTc-labeled TSH analogues to reduce the need for repeated tissue sampling.

  • Appropriate dosing: Research shows that even low doses of high-affinity TSHR ligands provide excellent imaging results while minimizing biological effects. Studies demonstrate that "the high specific activity and Kd of 99mTc-TR1402 allowed us to inject a very low amount of protein (approximately 30 μg), resulting in a high target-to-background ratio with no biological effects" .

  • Potential biological impacts: Consider that "the stimulation of the TSHR on metastatic lesions may lead to increased proliferation rate, tumor growth, and hormone release, as well as hyperthyroidism" . Protocols should include monitoring for these effects.

Clinical benefit assessment:

  • Therapeutic windows: When studying enhanced radioiodine uptake, researchers must balance maximizing tumor uptake while minimizing radiation exposure to normal tissues, adhering to the "as low as reasonably achievable" (ALARA) principle .

  • Translational value: Research should demonstrate clear potential for improving clinical outcomes in veterinary patients, not solely generating data for human applications.

Study design considerations:

  • Appropriate controls: Studies should employ rigorous controls and crossover designs where feasible, as demonstrated in research where "each dog received both treatments (ie, control and rhTSH) in a randomized order" .

  • Statistical power: Use the minimum number of animals required for statistical significance.

  • Dual benefit model: Design studies that simultaneously advance both veterinary medicine and human medicine, as exemplified by research concluding that TSHR-targeted imaging "could be an innovative technique to image dogs affected by thyroid cancer" while also being "a good candidate radiopharmaceutical to be translated in humans" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.