Recombinant Dog Transmembrane protein 47 (TMEM47)

Shipped with Ice Packs
In Stock

Description

Muscular Dystrophy Association

A 2.2-Mb inversion disrupting the DMD and TMEM47 genes was linked to X-linked muscular dystrophy in Labrador Retrievers :

ParameterObservation
Clinical phenotypeOverlaps with GRMD (Golden Retriever MD)
TMEM47 disruptionCo-occurred with ectopic Dp71 isoform expression
Modifier genes (LTBP4, Jagged1)No polymorphisms detected

Functional Rescue in C. elegans

Canine TMEM47 rescued vab-9 mutations in C. elegans, despite low sequence similarity (27% identity) :

TMEM47 VariantLocalizationRescue Efficacy
Full-length TMEM47-GFPApical junctional complexFull phenotypic rescue
TMEM47(ΔN)-GFPLateral membranesPartial rescue

Chemoresistance in Cancer

TMEM47 overexpression correlates with drug resistance in human cancers, suggesting conserved roles in canines :

Table: TMEM47 Modulation in MCF-7 Breast Cancer Cells

Cell LineIC50 (μM) for TamoxifenApoptosis Rate (%)
Wild-type MCF-71.58 ± 0.199.68
TMEM47-OE/MCF-73.12 ± 0.325.00
TAMR/MCF-7 (siRNA knockdown)1.36 ± 0.2711.53

Key mechanisms include:

  • Suppression of caspase-mediated apoptosis .

  • Enhanced drug efflux via multi-drug resistance-associated protein 1 (MRP1) .

Antiviral Regulation

Zebrafish TMEM47 homolog studies reveal its role in degrading MAVS/STING via autophagy, dampening IFN production . While canine-specific data are lacking, this suggests potential immune-modulatory functions.

Recombinant Expression Strategies

Although no direct studies on recombinant canine TMEM47 exist, analogous systems provide insights:

  • Host systems: E. coli (for membrane proteins) , mammalian cells (for post-translational modifications) .

  • Purification: Affinity tagging (e.g., GFP fusion) .

Potential Applications

ApplicationRationale
Disease modelingStudy X-linked muscular dystrophy mechanisms
Drug resistance screeningDevelop inhibitors targeting TMEM47 pathways
Cell junction dynamicsProbe epithelial barrier regulation

Future Directions

  • Structural studies: Co-crystallization with collagen or adhesion proteins .

  • Therapeutic targeting: Small-molecule inhibitors to reverse chemoresistance .

  • Canine-specific assays: Validate immune and neural roles using recombinant protein .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
TMEM47; BCMP1; TM4SF10; Transmembrane protein 47; Brain cell membrane protein 1; Transmembrane 4 superfamily member 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
TMEM47
Target Protein Sequence
MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRK PASLDIWHCESTLSSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLF AAVVLQVCSLVLYPIKFIETVSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDY Y
Uniprot No.

Target Background

Function
Transmembrane protein 47 (TMEM47) regulates cell junction organization in epithelial cells. It may play a role in the transition from adherens junctions to tight junction assembly. TMEM47 potentially regulates F-actin polymerization required for tight junctional localization dynamics and affects the junctional localization of PARD6B. During podocyte differentiation, it may negatively regulate the activity of FYN, subsequently affecting the abundance of nephrin.
Database Links

KEGG: cfa:403572

STRING: 9615.ENSCAFP00000020352

UniGene: Cfa.89

Protein Families
TMEM47 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, adherens junction.
Tissue Specificity
Highly expressed in brain.

Q&A

What are the main challenges in expressing recombinant transmembrane proteins like TMEM47?

Expressing recombinant transmembrane proteins like TMEM47 presents several significant challenges:

  • Low expression levels: Transmembrane proteins generally show poor expression in host cells due to their complex structure and dependence on cell membrane environments .

  • Stability issues: These proteins often demonstrate poor stability after leaving their natural cell membrane environment, making them prone to denaturation or aggregation during purification and subsequent experiments .

  • Structural complexity: The multiple transmembrane domains create epitope accessibility problems and complex dynamic conformations that present unique obstacles for structural characterization and antibody development .

  • Proper folding: Ensuring correct protein folding in heterologous expression systems is particularly challenging for transmembrane proteins due to their hydrophobic regions and complex topology.

These challenges necessitate specialized approaches for successful expression and study of TMEM47 and similar transmembrane proteins.

What expression systems are recommended for producing recombinant canine TMEM47?

For optimal expression of recombinant canine TMEM47, researchers should consider the following approaches:

  • Eukaryotic expression systems: Since the hydrophobic regions of transmembrane proteins like TMEM47 are prone to form inclusion bodies in prokaryotic cells, and prokaryotes struggle with processing complex eukaryotic signaling peptides and post-translational modifications, eukaryotic expression systems are preferable. Mammalian cell lines, insect cells, or yeast expression systems may facilitate correct folding and expression of TMEM47 .

  • Optimized expression conditions: Researchers should systematically optimize temperature, inducer concentration, expression vector design, and host strain selection to improve the soluble expression and functional yield of TMEM47 .

  • Solubilization tags: Introduction of solubilization tags such as Small Ubiquitin-associated Modifier (SUMO) or Maltose Binding Protein (MBP) can significantly increase protein solubility and functional yield .

  • Sequence optimization: Strategic adjustments to nucleotide or amino acid sequences can significantly impact expression levels and proper folding of TMEM47. Codon optimization for the chosen expression system and modification of particularly problematic sequence regions may improve results .

These approaches should be evaluated experimentally to determine the optimal system for a particular research application.

How can researchers effectively detect and quantify TMEM47 expression in canine tissues and cell lines?

Detecting and quantifying TMEM47 in canine tissues presents challenges due to limited availability of canine-specific reagents. Based on current research protocols, a comprehensive approach would include:

  • mRNA quantification via RT-qPCR:

    • Design primers specific to canine TMEM47 (based on sequence Q9XSV3)

    • Extract total RNA using commercially available reagents like TRIzol

    • Perform reverse transcription using a High-Capacity cDNA RT kit

    • Conduct qPCR using appropriate reference genes (18S rRNA for tissue samples, β-actin for cell lines)

    • Run PCR conditions: 95°C for 10 min, followed by 40 cycles of 95°C for 15 sec and 60°C for 1 min

  • Protein detection via Western blotting:

    • Note that commercially available antibodies against human TMEM47 may have limited cross-reactivity with canine TMEM47

    • Consider generating custom antibodies against canine-specific epitopes

    • Use validated protein extraction protocols for membrane proteins, including appropriate detergents

    • Include positive controls from tissues known to express TMEM47 (e.g., brain tissue)

  • Immunohistochemistry considerations:

    • Standard antibody-based detection has proven challenging, as researchers have reported inability to detect TMEM47 protein in wild-type dog brain tissue using commercial antibodies raised against human epitopes

    • Consider fluorescent tagging approaches for recombinant expression studies

These methodological challenges emphasize the need for development of canine-specific TMEM47 detection reagents to advance research in this area.

What functional assays can be used to study the role of TMEM47 in drug resistance mechanisms?

Based on established protocols from human cancer research, the following functional assays would be appropriate for investigating TMEM47's role in drug resistance in canine cells:

  • Drug cytotoxicity assays:

    • Culture cells in 96-well plates

    • Treat with appropriate drug concentration gradients (e.g., 0-100 μM)

    • After 48 hours incubation, assess cell viability using Cell Counting Kit-8 (CCK-8)

    • Calculate IC50 values to quantify resistance levels

    • Compare IC50 between wild-type, TMEM47-overexpressing, and TMEM47-knockdown cells

  • TMEM47 overexpression and knockdown methodology:

    • For overexpression: Use lentiviral ORF clones of GFP-tagged TMEM47

    • For knockdown: Employ TMEM47-specific short hairpin RNA (shRNA) lentiviral transduction particles

    • Include appropriate control vectors in all experiments

    • Verify expression changes at both mRNA and protein levels

  • Apoptosis assessment:

    • Treat cells with relevant chemotherapeutic agents

    • Use flow cytometry with Annexin V/PI staining to measure apoptosis rates

    • Compare early phase, late phase, and total apoptosis between different experimental groups

This approach has revealed significant differences in drug sensitivity and apoptosis in human cancer models, as shown in the following data from tamoxifen resistance studies:

SamplesApoptosis Rate (%)
Early phaseLate phaseTotal
Wild-type cells6.633.059.68
Drug-resistant cells2.800.363.16
Control vector7.921.809.72
TMEM47-overexpressing cells3.991.015.00
Resistant cells (control siRNA)6.651.207.85
Resistant cells (TMEM47 siRNA)5.456.0811.53

These data demonstrate that TMEM47 overexpression reduces apoptosis rates while TMEM47 knockdown increases apoptosis, suggesting a mechanistic role in drug resistance .

How does canine TMEM47 compare structurally and functionally to human TMEM47, and what implications does this have for translational research?

When investigating canine TMEM47 as a model for human applications, researchers should consider:

  • Sequence homology analysis:

    • Perform comparative sequence analysis between canine (UniProt: Q9XSV3) and human TMEM47

    • Focus particularly on conservation of transmembrane domains and functional motifs

    • Use tools like BLAST, Clustal Omega, and specialized transmembrane prediction algorithms

  • Structural modeling approaches:

    • Generate computational models of both canine and human TMEM47 using specialized membrane protein modeling tools

    • Compare predicted structures, particularly regarding transmembrane topology

    • Identify conserved binding sites or interaction domains that may be functionally significant

  • Functional conservation assessment:

    • Current evidence suggests some functional conservation, as TMEM47 has been investigated for roles in both species

    • While TMEM47's candidacy for X-linked mental retardation has been dismissed in humans , its abundant expression in canine brain suggests neurological functions

    • Research indicates functional roles in drug resistance mechanisms across species, with evidence from both human hepatocellular carcinoma and breast cancer studies

  • Translational considerations:

    • The functional role of TMEM47 in chemoresistance appears conserved between species, suggesting canine models could be valuable for human oncology research

    • For immunotherapy applications, differences in epitope accessibility and antibody cross-reactivity must be carefully evaluated

    • Consider that while some studies successfully combined CD47 blockade with anti-CD20 immunotherapy in canine lymphoma models , translating TMEM47-targeted approaches may require species-specific optimization

Understanding these comparative aspects is crucial for researchers using canine models to investigate TMEM47-related pathways with translational potential.

What are the proposed mechanisms by which TMEM47 contributes to drug resistance in cancer cells, and how can these be experimentally validated in canine models?

Based on human cancer studies, TMEM47 contributes to drug resistance through several potential mechanisms that can be investigated in canine models:

  • Regulation of drug efflux and metabolism pathways:

    • TMEM47 inhibition suppresses cisplatin-induced activation of genes involved in drug efflux and metabolism

    • TMEM47 expression correlates significantly with multi-drug resistance-associated protein 1 (ABCC1) in human HCC patients

    • Experimental approach: Measure expression of canine drug transporters (e.g., ABCB1, ABCC1) in TMEM47-modulated cells using RT-qPCR and Western blot analyses

  • Inhibition of apoptotic pathways:

    • Targeted inhibition of TMEM47 enhances caspase-mediated apoptosis in chemoresistant cells

    • TMEM47 overexpression suppresses apoptosis while knockdown increases it

    • Experimental approach: Assess activation of caspase-3, caspase-9, and PARP cleavage in TMEM47-modulated canine cells treated with chemotherapeutic agents

  • Effects on cellular morphology and junction assembly:

    • TMEM47 plays roles in regulating morphology and assembly of tight junctions by affecting localization of junction proteins

    • Experimental approach: Examine localization of tight junction proteins (claudins, occludin) and adherens junction proteins (cadherins) in TMEM47-modulated canine cells using immunofluorescence microscopy

  • In vivo validation approaches:

    • Establish xenograft models using canine cancer cells with TMEM47 overexpression or knockdown

    • Administer relevant chemotherapeutic agents (e.g., cisplatin at 5 mg/kg/week via intraperitoneal injection)

    • Monitor tumor growth over time and calculate tumor volumes

    • Compare treatment response between wild-type and TMEM47-modulated tumors

The relationship between TMEM47 expression and drug resistance is evidenced by IC50 values from human cancer studies:

SamplesIC50 for TamoxifenResistance Index
Wild-type cells1.58 ± 0.19/
Drug-resistant cells2.74 ± 0.241.74
Control vector1.36 ± 0.27/
TMEM47-overexpressing cells3.12 ± 0.322.30

This data demonstrates that TMEM47 overexpression increases the IC50 value for tamoxifen, confirming its role in drug resistance .

What purification strategies are most effective for recombinant canine TMEM47?

Purifying recombinant TMEM47 requires specialized approaches due to its transmembrane nature. Based on established membrane protein purification methods, researchers should consider:

  • Detergent selection:

    • Screen multiple detergents (mild non-ionic detergents like DDM, LMNG, or digitonin) for optimal solubilization

    • Consider detergent mixtures that maintain protein stability and function

    • Test lipid-like peptide detergents that may better mimic the native membrane environment

  • Affinity purification optimization:

    • Use affinity tags that are compatible with detergent-solubilized proteins

    • Position tags to minimize interference with protein folding or function

    • Consider dual tag approaches (e.g., His-tag combined with FLAG or STREP tags)

    • Include protease cleavage sites for tag removal if required for functional studies

  • Stability enhancement strategies:

    • Include appropriate lipids during purification to maintain stability

    • Optimize buffer conditions (pH, ionic strength, glycerol content)

    • Consider adding specific stabilizing agents like cholesteryl hemisuccinate

    • Explore nanodiscs or amphipols for transferring purified protein into more stable environments

  • Quality control assessment:

    • Validate purified protein using size exclusion chromatography to confirm monodispersity

    • Employ circular dichroism to assess secondary structure

    • Perform functional assays specific to TMEM47's known activities

    • Use mass spectrometry to confirm protein identity and assess post-translational modifications

These strategies should be empirically tested and optimized for the specific recombinant canine TMEM47 construct being studied.

How can researchers establish reliable in vitro models to study TMEM47 function in canine cancer drug resistance?

To establish reliable in vitro models for studying TMEM47's role in canine cancer drug resistance, researchers should implement the following methodological approach:

  • Cell line selection and validation:

    • Choose canine cancer cell lines relevant to the cancer type being studied

    • Characterize baseline TMEM47 expression in these lines using RT-qPCR and Western blot

    • Confirm species authenticity and absence of cross-contamination through STR profiling

  • Generation of drug-resistant canine cell variants:

    • Expose cells to gradually increasing concentrations of chemotherapeutic agents (similar to approaches used for human cancer cells)

    • Maintain cells at IC50 drug concentrations to sustain the resistant phenotype

    • Characterize acquired resistance through cytotoxicity assays and calculation of resistance indices

    • Confirm TMEM47 expression changes in resistant variants compared to parental cells

  • TMEM47 genetic modification approaches:

    • Establish TMEM47-overexpressing lines using lentiviral transduction systems

    • Generate TMEM47-knockdown models using shRNA or CRISPR-Cas9 techniques

    • Include appropriate vector controls and validate expression changes

    • Example protocol elements:

      • Use lentiviral ORF clones with GFP tags for visualization

      • Produce viral particles in packaging cells like 293T

      • Select stable transductants using appropriate selection markers

      • Validate expression changes at mRNA and protein levels

  • Functional characterization:

    • Compare drug sensitivity profiles between parental, TMEM47-overexpressing, and TMEM47-knockdown cells

    • Assess mechanisms of resistance through apoptosis assays, drug accumulation studies, and analysis of relevant signaling pathways

    • Evaluate effects on cellular morphology, junction formation, and interaction with other proteins

    • Perform rescue experiments to confirm specificity of observed phenotypes

This systematic approach will provide robust in vitro models for investigating TMEM47's functions in canine cancer drug resistance, enabling comparative studies with human systems.

What are the future research directions for canine TMEM47 studies and their translational potential?

The current state of TMEM47 research suggests several promising future directions:

  • Development of canine-specific research tools:

    • Generation of canine TMEM47-specific antibodies, as current antibodies to human epitopes show limited cross-reactivity with canine TMEM47

    • Creation of reporter systems for monitoring TMEM47 expression and localization in live cells

    • Development of high-throughput screening methods to identify modulators of TMEM47 function

  • Mechanistic studies:

    • Identification of TMEM47 interaction partners in canine cells through techniques like co-immunoprecipitation followed by mass spectrometry

    • Investigation of TMEM47's role in cell signaling pathways beyond drug resistance

    • Elucidation of the structural basis for TMEM47's functions through advanced structural biology approaches

  • Translational applications:

    • Evaluation of TMEM47 as a biomarker for predicting chemotherapy response in canine cancers, similar to its biomarker potential in human HCC

    • Development of TMEM47-targeting strategies to overcome drug resistance in canine cancers

    • Comparative oncology studies examining TMEM47's role across species to inform human cancer treatment

    • Assessment of TMEM47 as a therapeutic target, based on findings that targeted inhibition enhances chemosensitivity

  • Broader biological functions:

    • Exploration of TMEM47's roles in normal physiology, particularly in brain tissue where it's abundantly expressed

    • Investigation of potential roles in canine development, given its involvement in junction assembly

    • Comparison of tissue-specific expression patterns between canines and other species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.