Recombinant Dog Type-1 angiotensin II receptor (AGTR1)

Shipped with Ice Packs
In Stock

Description

Research Tools and Assays

A specialized ELISA kit (CNEB0284) enables precise quantification of AGTR1 in canine biological samples :

ParameterSpecification
Detection Range15.6–1,000 pg/mL
Sensitivity<9.4 pg/mL
Intra-Assay CV<10%
Inter-Assay CV<12%
Sample TypesSerum, plasma, tissue homogenates
Target Uniprot IDP43240

This assay demonstrates 100% specificity for canine AGTR1 with no cross-reactivity to other angiotensin receptors .

Pathophysiological Relevance in Canine Disease

Recent studies reveal critical associations:

Degenerative Mitral Valve Disease (DMVD)

  • Plasma AGTR1 levels correlate with disease severity (r=0.72,p<0.01r=0.72, p<0.01)

  • ARB treatment increases angiotensin 1–7 (Ang1–7) by 42% compared to ACE inhibitors

  • Combined ARB + rhACE2 therapy enhances beneficial APs while reducing Ang II by 95%

Therapeutic Responses

TreatmentAng II ReductionAng1–7 Increase
Telmisartan68%142%
Telmisartan+rhACE296%298%

Data from 24 dogs with Stage B2 DMVD showing median changes from baseline .

Constitutive Activity and Mutational Studies

The N111G mutation induces constitutive receptor activation:

  • Increases basal IP3 production by 320% vs wild-type

  • Alters β-arrestin recruitment kinetics (t₁/₂ = 18 vs 8 min)

  • Enhances ERK1/2 phosphorylation without ligand binding

These properties enable identification of inverse agonists like candesartan, which suppress basal activity by 89% in mutant receptors .

Production and Stability

Recombinant canine AGTR1 is typically expressed in mammalian systems for proper post-translational modification:

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your demand.
Lead Time
Delivery time may vary based on purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT CLSIDRYVAIVHPMKSPVRRTMLMAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKTLKRAYEIQKNKPRNDDIFK IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKIADIVDTAMPITICIAYFNNCLNPL FYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDHGNASTKKSASCVEVE
Uniprot No.

Target Background

Function
The angiotensin II type 1 receptor (AGTR1) is a receptor for angiotensin II. It mediates its action by associating with G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Adrenal, liver, aorta, kidney, lung, testis and heart.

Q&A

What is the structural and functional characterization of canine AGTR1?

Canine AGTR1 is a G protein-coupled receptor (GPCR) that mediates most physiological actions of angiotensin II (Ang II). The receptor binds its endogenous ligand Ang II with high structural specificity and affinity. Structurally, canine AGTR1 shares significant homology with human AGTR1, with conserved transmembrane domains and binding sites. The receptor is primarily expressed in vascular tissues, including skin and lung, where it regulates vascular tone, proliferation of vascular smooth muscle cells, extracellular matrix generation, and inflammation .

Functionally, AGTR1 activation initiates intracellular signaling cascades that lead to vasoconstriction, aldosterone release, and sodium retention. In dogs, AGTR1 has been extensively studied in cardiovascular physiology and pathophysiology, particularly in models of heart failure and hypertension. Similar to rodents, which have two subtypes (AT1Ra and AT1Rb), canine AGTR1 demonstrates high homology with the human receptor, making it valuable for translational research .

What methods are recommended for expressing and purifying recombinant dog AGTR1?

The expression and purification of recombinant dog AGTR1 typically employs mammalian expression systems to ensure proper post-translational modifications and folding. The methodological approach involves:

  • Vector selection: Using mammalian expression vectors containing strong promoters (such as CMV) and appropriate selection markers.

  • Cell line selection: HEK293 or CHO cells are preferred for GPCR expression due to their human-like glycosylation patterns and robust expression capabilities.

  • Transfection optimization: Lipid-based transfection reagents typically yield higher expression of functional GPCRs compared to electroporation or calcium phosphate methods.

  • Stable cell line development: Selection of stably transfected cells using appropriate antibiotics followed by clonal selection to identify high-expressing clones.

  • Solubilization and purification: Using mild detergents like DDM (n-dodecyl β-D-maltoside) or digitonin for membrane solubilization, followed by affinity chromatography using tags such as His, FLAG, or 1D4.

Recent approaches have incorporated nanodiscs or styrene-maleic acid lipid particles (SMALPs) to maintain the receptor in a more native-like lipid environment during purification, which helps preserve functionality for downstream applications .

How can researchers validate the functionality of recombinant dog AGTR1?

Functional validation of recombinant dog AGTR1 requires multiple complementary approaches:

  • Ligand binding assays: Radioligand binding using [125I]-labeled angiotensin II can confirm proper folding and ligand recognition. Competitive binding assays with selective AT1R antagonists like valsartan verify receptor specificity. The binding affinity (Kd) and receptor density (Bmax) should be determined through saturation binding experiments .

  • Signal transduction assays: Calcium mobilization assays using fluorescent indicators like Fluo-4 AM can measure AGTR1 activation. Alternatively, IP accumulation assays detect Gq protein coupling, while cAMP inhibition assays assess Gi coupling.

  • Receptor internalization: Fluorescently-tagged AGTR1 can be monitored for agonist-induced internalization using confocal microscopy or flow cytometry.

  • Downstream signaling: Western blotting for phosphorylated ERK1/2, phospholipase C activation, or RhoA activation confirms proper signal transduction.

  • Electrophysiology: Patch-clamp techniques can measure ion channel modulation in response to AGTR1 activation.

Receptor autoradiography using [125I]-labeled angiotensin II has been effectively used to quantify AGTR1 expression, with specificity confirmed by displacement with valsartan (an AGTR1 antagonist) but not PD123319 (an AT2R antagonist) .

How does recombinant dog AGTR1 compare to endogenous AGTR1 in binding studies with angiotensin receptor blockers (ARBs)?

Recombinant and endogenous dog AGTR1 exhibit similar pharmacological profiles when interacting with ARBs, though several considerations are important for comparative binding studies:

  • Binding kinetics: Recombinant dog AGTR1 typically demonstrates comparable binding affinities (Ki values) to endogenous receptors when expressed in mammalian systems. Studies with telmisartan (an ARB) show consistent displacement of angiotensin II in both recombinant systems and native tissues.

  • Receptor density effects: Recombinant systems often express higher receptor densities than native tissues, which can affect apparent binding affinities due to receptor reserve phenomena. Careful normalization for receptor expression levels is essential when comparing IC50 values.

  • Allosteric modulation: When studying combination therapies, such as ARBs with recombinant human ACE2 (rhACE2), recombinant systems allow for controlled investigation of complex interactions. For example, telmisartan treatment combined with rhACE2 showed a 1.9-fold higher concentration of Ang1-7 compared to ACEI with rhACE2, demonstrating the value of recombinant systems in studying drug interactions .

  • Functional readouts: Beyond binding studies, functional responses such as Gq-mediated calcium signaling and ERK1/2 phosphorylation should be compared between recombinant and endogenous systems to ensure translational relevance.

A comparative binding table based on available data demonstrates these relationships:

CompoundRecombinant Dog AGTR1 Ki (nM)Native Dog AGTR1 Ki (nM)Selectivity vs. AT2R
Telmisartan0.8-3.51.2-4.0>10,000-fold
Valsartan2.7-9.43.5-12.0>1,000-fold
Losartan10.0-22.012.0-25.0>100-fold

What role does recombinant dog AGTR1 play in studying canine cardiovascular diseases and potential treatments?

Recombinant dog AGTR1 serves as a crucial tool in investigating canine cardiovascular diseases, particularly degenerative mitral valve disease (DMVD), and in developing targeted treatments:

  • Receptor-ligand interaction studies: Recombinant dog AGTR1 allows for detailed characterization of interactions with both orthosteric ligands (angiotensin II) and allosteric modulators, providing insights into potential therapeutic targets.

  • Comparative drug development: Studies using dogs with DMVD have demonstrated that ARBs like telmisartan alter the angiotensin peptide (AP) profile differently than ACE inhibitors (ACEIs). Dogs receiving ARBs showed higher plasma concentrations of Ang1-7, a beneficial peptide with vasodilatory and anti-inflammatory properties .

  • Novel therapeutic approaches: The combination of ARBs with recombinant human ACE2 (rhACE2) has shown promise in preclinical studies. When plasma from dogs receiving telmisartan was incubated with rhACE2, there was a 1.9-fold higher concentration of Ang1-7 and a 17.2-fold higher concentration of Ang1-5 compared to the ACEI + rhACE2 group, indicating a more favorable AP profile .

  • Disease modeling: Recombinant dog AGTR1 expressed in cellular systems allows for the modeling of pathological states, such as receptor upregulation or constitutive activation, which occur in various cardiovascular conditions.

  • Biomarker development: Studies correlating AGTR1 expression levels with disease progression help identify potential biomarkers. For instance, in neuroendocrine neoplasms, AGTR1 mRNA levels were found to be 3.6-fold higher in tumor samples compared to controls, suggesting potential diagnostic applications .

How can researchers design experiments to investigate AT1R autoantibody interactions with recombinant dog AGTR1?

Designing rigorous experiments to investigate AT1R autoantibody interactions with recombinant dog AGTR1 requires a multifaceted approach:

  • Expression system optimization: Recombinant dog AGTR1 should be expressed in mammalian cells (HEK293 or CHO) to maintain proper glycosylation and conformational epitopes recognized by autoantibodies. The receptor should be tagged (e.g., FLAG or HA) at the N-terminus to avoid interfering with antibody binding sites.

  • Autoantibody isolation: Purification of AT1R autoantibodies from canine serum can be achieved using protein A/G columns followed by affinity chromatography against immobilized recombinant AGTR1. Alternatively, recombinant AT1R-specific monoclonal antibodies can be generated, similar to the mAT1R Ab used in mouse models .

  • Binding characterization:

    • ELISA assays using immobilized recombinant AGTR1 and purified autoantibodies

    • Surface plasmon resonance (SPR) to determine binding kinetics (kon, koff, Kd)

    • Flow cytometry to assess antibody binding to AGTR1-expressing cells

  • Functional consequences assessment:

    • Calcium mobilization assays to determine if antibodies act as agonists or antagonists

    • MAPK/ERK phosphorylation studies to assess downstream signaling

    • Receptor internalization assays using fluorescently-tagged AGTR1

  • Epitope mapping: Alanine scanning mutagenesis or hydrogen-deuterium exchange mass spectrometry can identify specific binding sites. Previous research has identified AT1R peptide 149-172 as immunogenic in mouse models .

  • In vivo validation: Administration of purified AT1R autoantibodies to dogs can assess pathological effects. Studies in mice have shown that AT1R antibodies can induce skin and lung inflammation, which were diminished in AT1Ra/b knockout mice .

What methodological approaches are recommended for studying the crosstalk between AGTR1 and ACE2 pathways using recombinant proteins?

To effectively study the crosstalk between AGTR1 and ACE2 pathways using recombinant proteins, researchers should consider these methodological approaches:

  • Co-expression systems: Establish stable cell lines expressing both recombinant dog AGTR1 and canine ACE2 to study their interactions in a controlled environment. This allows for manipulation of expression levels and introduction of mutations to assess functional relationships.

  • Proximity-based interaction assays:

    • Förster Resonance Energy Transfer (FRET) using fluorescently-tagged AGTR1 and ACE2

    • Bioluminescence Resonance Energy Transfer (BRET) to detect potential physical interactions

    • Proximity Ligation Assay (PLA) to visualize protein-protein interactions in situ

  • Angiotensin peptide metabolism profiling:

    • Use liquid chromatography-mass spectrometry (LC-MS/MS) to quantify the conversion of angiotensin II to angiotensin 1-7 in the presence of recombinant proteins

    • Track peptide conversion kinetics using enzyme activity assays with fluorogenic substrates

  • Pathway modulation studies:

    • Selective activation/inhibition of AGTR1 using agonists (angiotensin II) or antagonists (telmisartan)

    • Manipulation of ACE2 activity using recombinant human ACE2 (rhACE2)

    • Assessment of downstream signaling using phospho-specific antibodies

  • Ex vivo applications: Incubate plasma samples from dogs with cardiac disease with rhACE2 to assess changes in angiotensin peptide profiles, as demonstrated in previous studies. This approach revealed that plasma from dogs receiving ARBs showed more pronounced beneficial shifts in angiotensin peptide profiles after rhACE2 incubation compared to those receiving ACEIs .

This experimental design has been validated in studies where incubation of plasma from dogs with heart disease with rhACE2 resulted in decreased AT2 and PRA-S levels and increased Ang1-7, Ang1-9, Ang1-5, and ALT levels, indicating a shift toward beneficial peptides .

What are the optimal quantification methods for measuring AGTR1 expression in canine tissues?

Accurate quantification of AGTR1 expression in canine tissues requires careful selection of complementary methods:

  • mRNA quantification:

    • Quantitative RT-PCR (qRT-PCR) with validated canine-specific primers offers high sensitivity and specificity for AGTR1 mRNA detection.

    • Digital droplet PCR (ddPCR) provides absolute quantification without standard curves, reducing variability between experiments.

    • RNA sequencing (RNA-Seq) offers broader context by simultaneously measuring other components of the renin-angiotensin system.

  • Protein quantification:

    • Receptor autoradiography using [125I]-labeled angiotensin II with competitive displacement by selective antagonists (valsartan for AGTR1, PD123319 for AT2R) provides reliable quantification of functional receptors. This method allows calculation of specific binding by comparing total binding to non-specific binding in the presence of excess antagonists .

    • Alternative quantification through gamma counter measurement of radioligand binding to tissue samples wiped from slides provides complementary data .

    • Western blotting with validated antibodies, though challenging due to the lack of highly specific AGTR1 antibodies.

  • Correlation approaches:

    • Studies have demonstrated good correlation between mRNA levels and binding levels for AGTR1 (Pearson r = 0.43, p ≤ 0.01, r² = 0.184), supporting the validity of using mRNA as a surrogate for protein expression .

    • Comparison with established neuroendocrine tumor markers like SSTR2 provides context for expression levels. In neuroendocrine neoplasms, AGTR1 was detected at approximately 10-fold higher expression levels than SSTR2 .

  • In situ approaches:

    • Immunohistochemistry with careful validation of antibody specificity

    • RNAscope for highly sensitive and specific mRNA detection at the cellular level

    • Functional imaging using fluorescent angiotensin II derivatives

How should researchers design dose-response studies with recombinant dog AGTR1?

Designing robust dose-response studies with recombinant dog AGTR1 requires careful consideration of experimental parameters:

  • Expression system selection:

    • Stable expression in mammalian cells (HEK293, CHO) provides consistent receptor levels for reliable dose-response curves.

    • Inducible expression systems allow titration of receptor density to model different physiological states.

    • Assessing receptor expression levels before each experiment ensures consistency across studies.

  • Dose range determination:

    • Preliminary studies should establish a wide concentration range (typically 10⁻¹² to 10⁻⁵ M) to capture the full sigmoidal response curve.

    • Use at least 8-10 concentration points with 3-4 replicates per concentration.

    • Include appropriate vehicle controls and positive controls (known AGTR1 agonists).

  • Response measurement optimization:

    • Select readouts that directly reflect receptor activation (calcium mobilization, IP3 production).

    • Include time-course measurements to capture both rapid (seconds to minutes) and delayed (hours) responses.

    • When possible, measure multiple downstream signals simultaneously to capture pathway-specific effects.

  • Data analysis considerations:

    • Use appropriate curve-fitting software (GraphPad Prism, R) to determine EC₅₀/IC₅₀ values and Hill coefficients.

    • Apply statistical tests to compare parameters between experimental conditions.

    • Report both potency (EC₅₀) and efficacy (maximum response) values.

  • Translation to in vivo models:

    • Correlate in vitro dose-response findings with in vivo dose studies, as exemplified in AGTC-501 vector studies where efficacy and toxicity were evaluated across low (1.2 × 10¹¹ vg/mL), mid (6 × 10¹¹ vg/mL), and high doses (3 × 10¹² vg/mL) .

    • Establish no-observed-adverse-effect levels (NOAELs) to guide dosing in further studies.

What techniques are available for investigating AGTR1 signaling pathways in different canine cell types?

Investigating AGTR1 signaling pathways in different canine cell types requires a diverse toolkit of complementary techniques:

  • Real-time signaling dynamics:

    • FRET-based biosensors for cAMP, DAG, IP3, and Ca²⁺ provide spatiotemporal resolution of second messenger changes.

    • Live-cell imaging with fluorescent protein-tagged signaling components reveals subcellular localization of signaling events.

    • Electrophysiology (patch-clamp) for measuring ion channel modulation downstream of AGTR1 activation.

  • Protein phosphorylation cascades:

    • Phospho-specific antibodies in Western blotting or ELISA formats detect activation of key kinases (ERK1/2, p38 MAPK, JNK).

    • Phosphoproteomics using mass spectrometry provides unbiased, global views of phosphorylation changes.

    • Kinase activity assays with selective inhibitors delineate specific pathway contributions.

  • Transcriptional responses:

    • qRT-PCR arrays targeting genes regulated by AGTR1 activation (e.g., inflammatory cytokines, extracellular matrix proteins).

    • RNA-Seq for genome-wide transcriptional changes following short-term and long-term receptor activation.

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding following AGTR1 activation.

  • Pathway perturbation approaches:

    • Pharmacological inhibitors at different levels of the signaling cascade.

    • siRNA or CRISPR-based knockdown/knockout of specific pathway components.

    • Expression of dominant-negative or constitutively active pathway components.

  • Cell type-specific considerations:

    • Vascular smooth muscle cells: focus on contractility assays, calcium signaling, and proliferation.

    • Cardiomyocytes: assess contractility, hypertrophy markers, and calcium handling.

    • Renal cells: examine sodium transport, fibrotic responses, and inflammatory pathways.

    • Endothelial cells: investigate apoptosis pathways, as studies have shown weak lung endothelial apoptosis in AT1R-immunized mice .

How do canine AGTR1 signaling pathways compare to those in humans and other model organisms?

Canine AGTR1 signaling pathways share significant similarities with human pathways but exhibit important species-specific differences that researchers must consider:

  • Core signaling pathways:

    • The primary Gαq/11 coupling leading to phospholipase C activation, IP3 generation, and calcium mobilization is conserved across species.

    • β-arrestin recruitment and receptor internalization mechanisms follow similar kinetics and patterns in canine and human AGTR1.

    • MAP kinase cascade activation (ERK1/2, p38, JNK) demonstrates comparable temporal profiles across species.

  • Species-specific differences:

    • Unlike humans with a single AGTR1 gene, rodents express two subtypes (AT1Ra and AT1Rb) with tissue-specific distribution patterns, complicating direct comparisons.

    • Canine AGTR1, like human AGTR1, exists as a single subtype and shares a high degree of homology with the human receptor, making it more translationally relevant than rodent models for certain applications .

    • Ligand binding affinities show subtle species differences, with some ARBs demonstrating slightly different potencies against canine versus human AGTR1.

  • Tissue-specific expression patterns:

    • Canine AGTR1 is expressed in vascular tissues including skin and lung, similar to humans .

    • Expression levels in cardiovascular tissues are comparable between dogs and humans, particularly in pathological states like heart failure.

    • Neural expression patterns show more variation between species, potentially affecting central effects of AGTR1 modulators.

  • Disease model relevance:

    • Naturally occurring canine degenerative mitral valve disease (DMVD) closely mimics human pathophysiology, making dogs excellent models for studying AGTR1's role in cardiac remodeling .

    • Dogs with DMVD demonstrate altered angiotensin peptide profiles when treated with ARBs versus ACEIs, similar to patterns observed in human heart failure patients .

    • Immune-mediated responses to AGTR1, such as autoantibody generation, show comparable pathological consequences across species .

What are the applications of recombinant dog AGTR1 in studying inflammatory and fibrotic conditions?

Recombinant dog AGTR1 provides valuable insights into inflammatory and fibrotic pathways with multiple research applications:

  • Inflammatory signaling characterization:

    • Recombinant dog AGTR1 expression systems allow detailed mapping of inflammatory signaling cascades activated by angiotensin II, including NF-κB activation and proinflammatory cytokine production.

    • Comparative studies with mutated receptors can identify critical residues involved in inflammatory signal transduction.

    • Time-resolved signaling analyses distinguish between acute and chronic inflammatory responses.

  • Autoimmune models:

    • AT1R-immunized mice develop perivascular skin and lung inflammation, lymphocytic alveolitis, and skin fibrosis, indicating AGTR1's role in autoimmune conditions .

    • The AT1R peptide 149-172 has been identified as immunogenic, capable of provoking lung inflammation when administered alone .

    • Application of monoclonal AT1R antibodies induced skin and lung inflammation in wild-type mice but not in AT1Ra/b knockout mice, demonstrating specificity .

  • Fibrosis investigations:

    • AT1R immunization resulted in increased skin thickness and a 48% increase in collagen expression compared to control mice, highlighting AGTR1's role in fibrotic processes .

    • Immunohistochemical analysis revealed activation of Smad2/3 signaling, a key fibrotic pathway, in AT1R-immunized mice .

    • Recombinant systems allow isolation of direct AGTR1-mediated fibrotic responses from indirect effects mediated by inflammatory cells.

  • Therapeutic target validation:

    • Screening of anti-fibrotic compounds against recombinant dog AGTR1 helps identify novel therapeutic candidates.

    • Structure-activity relationship studies using recombinant receptors can guide development of more selective AGTR1 modulators.

    • Assessment of combination therapies, such as AGTR1 antagonists with anti-inflammatory agents.

  • Biomarker development:

    • Correlation of AGTR1 expression levels with disease severity in inflammatory and fibrotic conditions.

    • Identification of AGTR1-dependent biomarkers that reflect pathway activation and could serve as therapeutic response indicators.

What insights can recombinant dog AGTR1 provide for development of targeted therapies in companion animal medicine?

Recombinant dog AGTR1 offers multiple avenues for advancing targeted therapies in companion animal medicine:

  • Species-specific drug development:

    • Screening compounds against recombinant dog AGTR1 allows identification of canine-selective AGTR1 modulators with optimized pharmacokinetics for veterinary applications.

    • Structure-activity relationship studies can guide modification of human ARBs to improve efficacy and safety in canine patients.

    • Comparative binding studies against recombinant AGTR1 from multiple species can identify compounds with favorable species selectivity profiles.

  • Diagnostic applications:

    • Development of radioligand binding assays using recombinant dog AGTR1 enables screening for AT1R autoantibodies in canine patients.

    • Expression profiling in various canine diseases can identify conditions where AGTR1-targeted imaging agents might be diagnostically useful.

    • Correlation of AGTR1 expression with disease progression in conditions like degenerative mitral valve disease provides prognostic markers .

  • Novel therapeutic strategies:

    • Investigation of combination therapies, such as ARBs with ACE2 activators, based on findings that telmisartan treatment combined with rhACE2 produced favorable shifts in angiotensin peptide profiles .

    • Development of bispecific antibodies or dual-action compounds targeting AGTR1 and complementary pathways.

    • Creation of allosteric modulators that selectively inhibit pathological AGTR1 signaling while preserving physiological functions.

  • Precision medicine approaches:

    • Identification of breed-specific or individual variations in AGTR1 sequence or expression that might predict response to targeted therapies.

    • Development of companion diagnostics to identify canine patients most likely to benefit from AGTR1-targeted interventions.

    • Patient-derived cell culture models expressing native AGTR1 for personalized drug sensitivity testing.

  • Translational applications:

    • Naturally occurring canine cardiovascular diseases provide valuable models for testing AGTR1-targeted therapies with potential human applications.

    • Findings from canine studies, such as the beneficial effects of telmisartan on angiotensin peptide profiles, may inform human therapeutic strategies .

    • One Health approaches that recognize the parallels between human and canine diseases mediated by AGTR1 activation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.