Recombinant Dog Type I iodothyronine deiodinase (DIO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DIO1; ITDI1; TXDI1; Type I iodothyronine deiodinase; 5DI; DIOI; Type 1 DI; Type-I 5'-deiodinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
DIO1
Target Protein Sequence
MGLPRPVLWLRRLWVLLQVAVQVAVGKVFLKLFPARVKQHIVAMNGKNPHFSYDNWAPTL YSMQYFWFVLKVQWQRLEDRTEPGGLAPNCPVVRLSGQRCNIWDFMQGNRPLVLNFGSCT UPSFLFKFDQFKRLIEDFCSTADFLIIYIEEAHASDGWAFKNNVNIRTHQTLQDRLQAAR LLLDRAPPCPVVVDTMRNQSSQFYAALPERLFVLQEGRILYKGKPGPWNYHPEEVRAVLE KLHS
Uniprot No.

Target Background

Function
Recombinant Dog Type I iodothyronine deiodinase (DIO1) is responsible for the deiodination of thyroxine (T4) to triiodothyronine (T3) and the subsequent deiodination of T3 to 3,3'-diiodothyronine (T2). It plays a crucial role in peripheral T3 production through T4 deiodination in tissues such as the liver and kidney.
Database Links

KEGG: cfa:403635

UniGene: Cfa.3500

Protein Families
Iodothyronine deiodinase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.