Recombinant Dog Zinc-activated ligand-gated ion channel (ZACN)

Shipped with Ice Packs
In Stock

Description

Functional Activation and Ion Permeability

Recombinant dog ZACN displays:

  • Zn²⁺ Activation: EC₅₀ ≈ 1–3 mM, comparable to human ZAC

  • H⁺ Sensitivity: Activated at pH 4.0, though with slower desensitization kinetics than other mammalian ZACs

  • Cation Selectivity: Permeable to Na⁺, K⁺, and Ca²⁺, but not anions

Key Findings from Electrophysiological Studies

  • Spontaneous activity observed in absence of agonists

  • Zn²⁺-evoked currents show prolonged activation phases (>30 sec)

  • No significant Cu²⁺-mediated activation reported in dog ZACN, unlike human orthologs

Comparative Pharmacology Across Mammalian ZACs

Functional data from Xenopus oocyte studies reveal interspecies variations:

SpeciesZn²⁺ EC₅₀ (mM)H⁺ Response (pH 4.0)Current Decay Profile
Dog2.4 ± 0.3Robust (IₚH₄.₀ = 1.5 μA)Slow decay (10–20% over 2 min)
Human1.8 ± 0.2RobustModerate decay (~50% over 2 min)
Cow2.1 ± 0.4RobustSlow decay
Horse3.1 ± 0.5NoneFast decay

Data derived from TEVC recordings

Research Applications and Limitations

  • Drug Discovery: Used to screen modulators targeting Zn²⁺-sensitive channels

  • Limitations: Lack of dog-specific antibodies and knockout models hinders in vivo validation

Unanswered Questions and Future Directions

  1. Does endogenous Zn²⁺ regulate dog ZACN in vivo, or is it activated by undiscovered ligands?

  2. How does the C-tail autoinhibition mechanism differ between human and dog ZACN?

  3. What structural variations account for the absence of H⁺ activation in horse ZACN but not dog ZACN?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ZACN; LGICZ; LGICZ1; Zinc-activated ligand-gated ion channel; Ligand-gated ion channel zinc-activated 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-409
Protein Length
Full Length of Mature Protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
ZACN
Target Protein Sequence
GPLVQGRGFRSPTVAWPSFFNFNQPQGVQETIQIPNNGSAPLLVDVQVFVSNVFNVDILR YTVSSMLLLRLSWVDTRLAWNASLYPQHAVTLPWDSLWTPGLTIQEALWVDWQDQSPRAR VGPDGHVDLYLALTTETNCDFELLHFPRDQSDCNLSFYALSNTVLELEFRAHAVNEIVSV KREYVVWGLETQIPPRQLVPCFQVTLRLQNTALKAIIALLVPGEALLLADMCGGLLPLRA TERIAYKVTLLLGYLVFHSSLVQALPSSSSCNPLLIYYFTVLLLLLFISTMETVLLAALQ ARGHLSARSSPIPTPRGEQQDHGDLGPHPEEAPGVKESRSWAEAADHIFFLVYVVGVVCS QFFFIGFWMWATCKSDPAPGEAIPHGGQPRL
Uniprot No.

Target Background

Function
Zinc-activated ligand-gated ion channel.
Database Links
Protein Families
Ligand-gated ion channel (TC 1.A.9) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Zinc-Activated Channel (ZAC) and how does it differ from other ligand-gated ion channels?

The Zinc-Activated Channel (ZAC) is a cation-permeable ligand-gated ion channel belonging to the "Cys-loop" superfamily. Unlike other members of this superfamily, ZAC exhibits very low homology (<20% amino acid sequence identity) to other members while still retaining most structural hallmarks of a pentameric ligand-gated ion channel (pLGIC) subunit. The ZACN gene encoding ZAC is exclusively found in mammalian genomes, including dogs, but notably absent in rodents such as mice and rats. The channel forms homomeric complexes that are primarily gated by zinc (Zn²⁺), copper (Cu²⁺), and protons (H⁺). Dog ZAC (clZAC) shares functional properties with human ZAC but exhibits distinct pharmacological characteristics .

What tissues express ZACN in dogs and other mammals?

ZACN mRNA is widely expressed across multiple tissues in mammals, including dogs. Expression has been documented in prostate, thyroid, trachea, lung, brain (both adult and fetal), spinal cord, skeletal muscle, heart, placenta, pancreas, liver, kidney, and stomach. This broad expression pattern suggests that ZAC may have diverse physiological roles across different organ systems, though its specific functions remain poorly understood .

What are the optimal expression systems for studying recombinant dog ZACN?

Two primary expression systems have proven effective for studying recombinant dog ZACN:

  • Mammalian cell lines: tsA201 cells (derived from human embryonic kidney cells) provide a robust system for protein expression studies. These cells effectively translate the ZACN cDNA and process the protein through appropriate post-translational modifications. For immunodetection purposes, introducing a hemagglutinin (HA) epitope tag facilitates reliable quantification of total and cell-surface expression through enzyme-linked immunosorbent assay (ELISA) .

  • Xenopus laevis oocytes: This system is particularly valuable for electrophysiological studies using two-electrode voltage-clamp (TEVC) recordings. Following injection of ZACN cRNA, functional channels can be detected within 2-3 days of incubation. This system allows for detailed characterization of channel properties, including agonist concentration-response relationships and channel kinetics .

The choice between these systems depends on the specific research questions being addressed, with mammalian cells offering advantages for protein expression studies and oocytes providing an excellent platform for functional characterization.

What methodological considerations are important when designing experiments to characterize dog ZACN pharmacology?

When characterizing dog ZACN pharmacology, several methodological considerations are crucial:

  • Agonist concentration range: Testing a wide concentration range of zinc (typically 0.03-10 mM) is essential to establish complete concentration-response curves. Due to the higher EC₅₀ values observed in some mammalian ZACs, concentrations up to 10 mM may be necessary to reach saturation .

  • pH control: Since protons (H⁺) can activate ZAC, careful pH control is critical during zinc application experiments to prevent confounding effects. Similarly, when studying proton activation (typically at pH 4.0), solutions must be properly buffered .

  • Expression level normalization: Current amplitudes can vary considerably between different ZACs, influenced by cRNA quantities and incubation periods. Standardizing these parameters is important for comparative studies .

  • Voltage protocols: Given the slow activation and desensitization kinetics of ZAC, extended recording protocols are necessary to capture complete channel responses. Holding potentials should be consistent across experiments (typically -60 mV) .

  • Spontaneous activity assessment: ZAC exhibits substantial spontaneous activity, which should be quantified to fully understand channel properties under different conditions .

How can structural determinants of zinc sensitivity in dog ZACN be identified through mutagenesis approaches?

Identifying structural determinants of zinc sensitivity in dog ZACN requires systematic mutagenesis approaches focused on potential zinc-binding residues:

This systematic approach can reveal key residues that determine zinc sensitivity and provide insights into the molecular mechanisms of zinc activation across different mammalian ZACs.

What approaches can be used to investigate the physiological functions of dog ZACN in native tissues?

Investigating physiological functions of dog ZACN in native tissues requires multifaceted approaches:

  • Tissue-specific expression profiling: Quantitative PCR and in situ hybridization can map ZACN expression patterns across different dog tissues, providing clues about potential physiological roles .

  • Immunohistochemistry: Develop specific antibodies against dog ZACN for protein localization in tissue sections. Double-labeling with markers for specific cell types can identify the cellular distribution of ZACN.

  • Electrophysiological recordings from native tissues: Patch-clamp recordings from freshly isolated cells or tissue slices, combined with pharmacological tools (zinc application, pH modulation), can identify native ZAC currents.

  • Zinc imaging: Since ZAC is zinc-sensitive, correlating local zinc dynamics with channel activity using zinc-sensitive fluorescent probes can provide functional insights.

  • CRISPR-mediated genome editing in dog cell lines: Generate ZACN knockouts in relevant dog cell lines to study effects on cellular function, particularly in tissues with high ZACN expression.

  • Comparative physiological studies: Since mice and rats lack ZACN orthologs, comparing physiological processes between these rodents and dogs might highlight functions specifically mediated by ZACN .

These complementary approaches can overcome the challenge of studying a channel whose physiological role remains poorly understood, potentially revealing novel zinc-dependent signaling mechanisms in mammals.

How does the amino acid sequence of dog ZACN compare to other mammalian species, and what are the implications for structure-function relationships?

Dog ZACN shares the general structural architecture of the Cys-loop receptor superfamily while exhibiting species-specific sequence variations:

  • Sequence conservation: Although ZAC proteins exhibit very low homology (<20%) to other members of the pLGIC superfamily, ZACN sequences are relatively well-conserved across mammals. Dog ZACN shares significant sequence identity with other mammalian ZACs, particularly in domains critical for channel function .

  • Structural domains: The dog ZACN protein contains the hallmark structural elements of pLGICs, including an extracellular N-terminal domain with the characteristic Cys-loop, four transmembrane domains (M1-M4), and intracellular loops. These domains are generally conserved across mammalian ZACs, though with variable sequence conservation .

  • Species-specific variations: Comparative analysis reveals higher variation in specific regions, particularly in the intracellular loop between M3 and M4 domains. These variations may contribute to the observed differences in channel kinetics and agonist potency between species .

  • Functional implications: Despite sequence variations, the conservation of functional ZAC across diverse mammalian lineages suggests strong evolutionary pressure to maintain this channel. This conservation extends to species with dramatically different physiological adaptations (e.g., aquatic manatees, flying bats, terrestrial ungulates), indicating that ZAC likely serves fundamental signaling functions in mammals .

Understanding these sequence relationships provides a framework for structure-function studies and may help identify critical residues responsible for the unique properties of ZAC channels.

What oligomeric structure does dog ZACN form, and how can this be experimentally determined?

Dog ZACN is believed to form homopentameric complexes like other members of the pLGIC superfamily, though its precise oligomeric structure requires experimental verification:

  • Biochemical approaches:

    • Cross-linking studies using chemical cross-linkers followed by SDS-PAGE analysis can reveal the oligomeric state

    • Blue native PAGE can identify native protein complexes

    • Size-exclusion chromatography combined with multi-angle light scattering (SEC-MALS) can determine the molecular weight of the intact complex

  • Structural biology techniques:

    • Cryo-electron microscopy (cryo-EM) represents the gold standard for determining pentameric ligand-gated ion channel structures

    • X-ray crystallography, though challenging for membrane proteins, has been successfully applied to related channels

    • Atomic force microscopy can visualize channel complexes in membrane environments

  • Functional approaches:

    • Concatemeric constructs containing multiple linked ZACN subunits can test assumptions about stoichiometry

    • Single-channel recordings can provide insights into the number of conducting states, which correlates with subunit composition

  • Computational methods:

    • Homology modeling based on structurally characterized pLGICs can predict the pentameric arrangement

    • Molecular dynamics simulations can assess the stability of predicted oligomeric assemblies

The combination of these approaches would provide comprehensive evidence regarding the oligomeric structure of dog ZACN and its similarity to other pLGIC family members.

What is the significance of ZACN conservation across mammals but absence in rodents for translational research?

The conservation of ZACN across diverse mammalian species, coupled with its notable absence in rodents (mice and rats), has significant implications for translational research:

  • Evolutionary insights: The widespread conservation of functional ZACN across mammals with vastly different physiologies (from aquatic manatees to terrestrial ungulates) suggests that ZAC serves fundamental biological functions. Yet, its absence in mice and rats indicates that rodents have evolved compensatory mechanisms or simply do not require the specific signaling mediated by ZAC .

  • Limitations of rodent models: The absence of ZACN orthologs in mice and rats creates a significant blind spot in traditional rodent-based research models. Any physiological processes mediated by ZAC cannot be directly studied in these common laboratory animals, potentially missing important aspects of mammalian biology .

  • Alternative model systems: For studying ZAC-related processes, researchers must consider alternative model organisms. The naked mole-rat and common degus (rodents that do possess functional ZACN genes) may serve as suitable small rodent models. For higher-order studies, dogs and pigs represent viable options as their ZACN genes produce functional proteins .

  • Translational relevance: Human ZACN function may not be accurately predicted from studies in mice or rats, creating challenges for drug development targeting ZAC-related pathways. Cross-species comparisons between humans, dogs, and other mammals with functional ZAC may provide more relevant insights for therapeutic applications .

This evolutionary pattern suggests that ZAC may mediate specialized signaling pathways that evolved differently across mammalian lineages, with potential implications for species-specific physiological adaptations.

How might ZACN function interact with zinc homeostasis mechanisms in health and disease?

The interaction between ZACN function and zinc homeostasis may involve complex bidirectional relationships with implications for both health and disease:

  • Zinc as a signaling molecule: Beyond its role as a structural and catalytic cofactor, zinc increasingly appears to function as an intracellular second messenger. ZACN may serve as one of the cellular sensors for fluctuations in zinc concentrations, potentially translating these changes into electrical signals or other cellular responses .

  • Tissue-specific zinc dynamics: ZACN is expressed in multiple tissues where zinc plays important physiological roles:

    • In the brain, synaptic zinc release may activate neuronal ZAC channels

    • In the prostate, which concentrates zinc, ZAC may respond to changes in zinc levels related to reproductive functions

    • In the pancreas, zinc co-released with insulin may activate ZAC in nearby cells

  • Pathophysiological implications: Disruptions in zinc homeostasis occur in various conditions:

    • Neurodegenerative diseases (Alzheimer's, Parkinson's) involve altered zinc metabolism

    • Prostate cancer is associated with reduced tissue zinc levels

    • Diabetes affects zinc handling in pancreatic cells

    In these conditions, altered zinc signaling through ZAC could potentially contribute to disease processes or represent compensatory mechanisms .

  • Integration with other zinc-sensitive channels: ZAC functions within a broader ecosystem of zinc-sensitive proteins. For example, KCNQ potassium channels are also modulated by intracellular zinc, potentially creating integrated zinc-responsive signaling networks. The interactions between these different zinc-sensing mechanisms likely contribute to coordinated cellular responses to zinc fluctuations .

Understanding these interactions could reveal new therapeutic targets for conditions involving disrupted zinc homeostasis, with potential applications in neurological disorders, cancer, and metabolic diseases.

What are the main challenges in expressing and characterizing recombinant dog ZACN, and how can they be addressed?

Researchers face several challenges when working with recombinant dog ZACN, each requiring specific methodological solutions:

ChallengeDescriptionSolution
Variable expression levelsDifferent mammalian ZACs show varying expression levels in heterologous systemsOptimize codon usage for the expression system; use stronger promoters; apply chaperone co-expression strategies; standardize cRNA quantities and incubation times for comparative studies
Slow channel kineticsZAC exhibits notably slow activation and desensitization kineticsDesign longer recording protocols (minutes rather than seconds); ensure stable recording conditions for extended measurements; analyze both steady-state and kinetic parameters separately
High zinc concentrationsCharacterizing full concentration-response relationships requires high zinc concentrations (up to 10 mM)Prepare stock solutions carefully; monitor for precipitation; control for osmolarity changes; consider using zinc ionophores for intracellular delivery when relevant
Spontaneous activitySubstantial baseline activity complicates the interpretation of agonist responsesQuantify spontaneous activity independently; use channel blockers to establish true baseline; normalize agonist responses to maximum rather than baseline
pH sensitivityZAC activation by protons can confound zinc activation studiesMaintain strict pH control; buffer solutions appropriately; separately characterize proton sensitivity to distinguish from zinc effects
Lack of specific pharmacological toolsFew specific activators or inhibitors exist for ZACDevelop new compounds through screening approaches; use molecular biology approaches (mutations, chimeras) to compensate for pharmacological limitations

Addressing these challenges requires careful experimental design and standardization of protocols across laboratories to ensure reproducible and comparable results in ZAC research.

How can native dog ZACN currents be distinguished from other zinc-sensitive channels in electrophysiological recordings?

Distinguishing native dog ZACN currents from other zinc-sensitive channels requires a strategic combination of pharmacological, biophysical, and molecular approaches:

  • Biophysical properties: ZAC channels exhibit distinctive kinetic properties:

    • Very slow activation (seconds to minutes)

    • Minimal desensitization during continued agonist application

    • Substantial spontaneous activity

    • Cation selectivity with minimal ion discrimination
      These properties differ from most other zinc-sensitive channels (such as KCNQ/M-channels or certain glutamate receptors) and can serve as initial identifiers .

  • Pharmacological profile: A comprehensive pharmacological approach includes:

    • Testing multiple ZAC agonists (zinc, copper, protons) to establish the characteristic activation profile

    • Comparing EC₅₀ values for zinc (typically in the 100-500 μM range for ZAC)

    • Using blockers of other known zinc-sensitive channels (e.g., TEA for potassium channels) to isolate ZAC currents

    • Testing for insensitivity to blockers of other major channel types .

  • Molecular approaches: More definitive identification can be achieved through:

    • RNA interference to specifically knock down ZACN expression in native preparations

    • Single-cell RT-PCR following electrophysiological recording to confirm ZACN expression in cells exhibiting the current

    • Heterologous expression of cloned dog ZACN to directly compare properties with native currents .

  • Combination analysis: Plotting current characteristics across multiple parameters (activation time, zinc EC₅₀, pH sensitivity, and current-voltage relationship) can create a "fingerprint" that distinguishes ZAC from other channels.

This multifaceted approach can provide compelling evidence for the molecular identity of native zinc-activated currents in dog tissues, facilitating further studies of physiological function.

What are promising strategies for identifying the physiological roles of ZACN in mammals?

Several innovative approaches hold promise for uncovering the physiological functions of ZACN in mammals:

  • Comparative genomics and transcriptomics: Analyzing ZACN expression patterns across species and tissues can reveal correlations with specific physiological processes. Particularly valuable would be comparisons between species with ZACN (humans, dogs) and those without (mice, rats) to identify compensatory mechanisms or uniquely ZACN-dependent functions .

  • Development of specific modulators: Designing selective agonists and antagonists for ZAC would provide powerful tools for probing its functions. High-throughput screening approaches using recombinant dog ZACN could identify lead compounds for further development into research tools.

  • CRISPR-based approaches: While mouse models lack ZACN, CRISPR/Cas9 editing in species that possess functional ZACN genes (such as naked mole-rats or dogs) could generate valuable knockout models. Alternatively, humanized mice expressing the human ZACN gene could be developed .

  • Zinc imaging combined with electrophysiology: Using zinc-sensitive fluorescent probes alongside electrophysiological recordings could correlate zinc fluctuations with ZAC activation in native tissues, helping to establish the physiological contexts in which ZAC signaling occurs.

  • Single-cell analyses: Applying single-cell RNA-seq and proteomics to identify cell populations where ZACN is highly expressed, followed by targeted functional studies of these specific cell types.

  • Transgenic reporter systems: Developing animal models with reporter genes under control of the ZACN promoter would facilitate visualization of ZACN-expressing cells and tissues throughout development and in response to various physiological stimuli.

These complementary approaches could overcome the current limitations in understanding ZAC function and potentially reveal new zinc-dependent signaling pathways in mammalian physiology.

How might understanding dog ZACN contribute to therapeutic developments for human conditions?

Understanding dog ZACN could contribute to therapeutic developments through several pathways:

  • Comparative pharmacology platform: Due to the absence of ZACN in rodents, dog ZACN offers a valuable comparative model for human ZACN. Pharmacological agents developed and tested on dog ZACN may provide better translational predictions for human applications than traditional rodent models .

  • Zinc-related disorders: Given that ZAC is zinc-activated, it may play roles in conditions involving zinc dysregulation:

    • Neurodegenerative diseases (Alzheimer's, Parkinson's) where zinc homeostasis is disrupted

    • Prostate disorders, as the prostate contains high zinc concentrations and expresses ZACN

    • Certain immune and inflammatory conditions where zinc signaling is implicated

  • Novel drug target classes: As a cation channel distinct from more commonly targeted ion channels, ZAC represents a potentially novel drug target class. Modulators of ZAC function could offer new therapeutic approaches with different mechanisms of action and side effect profiles compared to existing medications.

  • Veterinary applications: Direct applications in canine medicine could emerge from understanding dog ZACN, potentially benefiting companion animals while providing translational insights for human conditions.

  • Biomarker development: If specific physiological roles of ZACN are identified, it could serve as a biomarker for certain conditions or treatment responses, particularly in contexts where zinc signaling is disrupted.

The evolutionary conservation of ZACN across mammals (except rodents) suggests important biological functions that, once understood, may reveal new therapeutic opportunities for conditions affecting both humans and companion animals such as dogs.

What novel experimental techniques could advance the study of ZACN structure-function relationships?

Several cutting-edge techniques could significantly advance our understanding of ZACN structure-function relationships:

  • Cryo-electron microscopy (cryo-EM): High-resolution structural determination of dog ZACN would reveal critical insights into zinc binding sites, gating mechanisms, and structural differences from other pLGICs. Recent advances in cryo-EM have made it increasingly feasible to resolve structures of challenging membrane proteins like ion channels .

  • Unnatural amino acid mutagenesis: Incorporating unnatural amino acids with specific chemical properties at potential zinc-binding sites could provide precise information about coordination chemistry and binding energetics that conventional mutagenesis cannot achieve.

  • Single-molecule FRET: Applying fluorescence resonance energy transfer techniques to specifically labeled ZACN proteins could track conformational changes during channel gating in real-time, revealing the dynamics of channel activation by zinc.

  • Nanobody development: Generating camelid antibody fragments (nanobodies) that specifically recognize different conformational states of ZACN could stabilize the channel for structural studies and provide tools to probe conformational states in living cells.

  • Molecular dynamics simulations: With structural data as input, advanced computational approaches could model zinc binding, permeation pathways, and conformational transitions, providing mechanistic insights difficult to obtain experimentally.

  • Optogenetic and chemogenetic approaches: Engineering light-sensitive or designer drug-sensitive variants of ZACN would allow precise temporal control over channel activity in cellular and potentially in vivo systems.

  • Zinc photocaging: Developing photolabile zinc cages would enable precise spatiotemporal control of zinc release, allowing detailed studies of ZACN activation kinetics and localized responses.

These advanced techniques would move beyond traditional electrophysiology and mutagenesis approaches to provide deeper insights into the molecular mechanisms of ZACN function.

How can interspecies differences in ZACN be leveraged to understand channel evolution and function?

The natural variation in ZACN across mammalian species provides a valuable resource for understanding channel evolution and function:

  • Molecular evolution analysis: Systematic comparison of ZACN sequences across diverse mammalian lineages can identify:

    • Positively selected residues that may confer adaptive advantages

    • Conserved domains critical for core channel functions

    • Lineage-specific variations that might relate to specialized physiological adaptations

  • Chimeric channel approach: Creating chimeric channels that combine domains from different species' ZACNs (e.g., dog/human, dog/manatee) can identify regions responsible for functional differences in zinc sensitivity, kinetics, and other channel properties .

  • Ancestral sequence reconstruction: Computational reconstruction of ancestral ZACN sequences could allow expression and characterization of evolutionary intermediates, revealing the trajectory of channel evolution and key adaptive changes.

  • Comparative pharmacology: Systematically comparing pharmacological profiles of ZACNs from diverse mammals could:

    • Identify species-specific modulators

    • Reveal binding site differences

    • Develop more selective compounds for research tools

  • Correlation with ecological and physiological adaptations: Analyzing ZACN properties in context of species' unique adaptations (e.g., diving mammals, hibernating species, species with different zinc requirements) may reveal specialized functions.

  • Natural knockout models: The absence of ZACN in rodents provides a natural "knockout" for comparative physiology studies. Identifying compensatory mechanisms in these species could reveal redundant systems for zinc sensing .

This evolutionary approach can transform natural variation from a confounding factor into a powerful tool for understanding channel function, potentially revealing adaptations that could be harnessed for therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.