Recombinant Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1 (dad-1)

Shipped with Ice Packs
In Stock

Description

Production of Recombinant DAD-1

Recombinant DAD-1 refers to the artificially produced version of the protein generated through genetic engineering techniques. The production process typically involves inserting the DAD-1 gene into an expression vector, followed by introduction into a suitable host organism (bacterial, yeast, insect, or mammalian cells) that expresses the protein . Commercial recombinant DAD-1 proteins are available from various species, including Mesocricetus auratus (golden hamster) . These recombinant proteins serve as valuable tools for investigating DAD-1's biochemical properties, functional characteristics, and potential therapeutic applications.

The availability of recombinant DAD-1 enables researchers to study the protein's structure-function relationships, interaction partners, and roles in various cellular processes more effectively than would be possible with native protein isolated from tissues. This has significantly advanced our understanding of DAD-1's biological functions and potential clinical relevance.

Role in Protein N-Glycosylation

DAD-1 serves as an essential subunit of the oligosaccharyl transferase (OST) complex, which catalyzes a crucial step in protein N-glycosylation . This complex orchestrates the transfer of a high-mannose oligosaccharide (Glc₃Man₉GlcNAc₂ in eukaryotes) from dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains . This transfer constitutes the initial and defining step in the N-glycosylation process, a fundamental post-translational modification that influences protein folding, stability, and function.

The N-glycosylation process occurs cotranslationally, meaning that it takes place as the protein is being synthesized by ribosomes . The OST complex, including DAD-1, associates with the Sec61 complex at the channel-forming translocon complex, which facilitates protein translocation across the endoplasmic reticulum membrane . This strategic positioning enables the OST complex to access nascent polypeptide chains as they emerge from the ribosome and enter the endoplasmic reticulum lumen.

The reaction catalyzed by the OST complex can be represented as:

Dolichyl diphosphooligosaccharide + protein L-asparagine → dolichyl diphosphate + glycoprotein (with oligosaccharide chain attached by N-glycosyl linkage to protein L-asparagine)

Anti-Apoptotic Function

Beyond its role in protein glycosylation, DAD-1 functions as a critical negative regulator of programmed cell death (apoptosis) . The protein was originally identified in a temperature-sensitive cell line (TSBN7) where a mutation in DAD-1 induced apoptosis when cells were shifted to a non-permissive temperature . This discovery led to its designation as "Defender Against apoptotic cell Death 1," highlighting its protective role against cellular self-destruction pathways.

Several important observations regarding DAD-1's anti-apoptotic function have been documented:

  1. Loss of DAD-1 triggers apoptosis in various cellular systems

  2. DAD-1 depletion-induced apoptosis can be inhibited by cycloheximide (a protein synthesis inhibitor) but not by Bcl-2 (a conventional anti-apoptotic molecule)

  3. DAD-1 interacts with Mcl-1, an anti-apoptotic member of the Bcl-2 family, suggesting potential crosstalk between different apoptotic regulatory pathways

  4. Enhanced expression of DAD-1 has been observed in response to cellular injury or apoptotic stimuli, suggesting a protective compensatory mechanism

Components of the Oligosaccharyltransferase Complex

DAD-1 functions as an integral component of the oligosaccharyltransferase (OST) complex, a multiprotein assembly responsible for catalyzing N-linked glycosylation . The OST complex exists in different forms but generally contains at least seven subunits: RPN1, RPN2, OST48, DAD-1, OSTC, KRTCAP2, and either STT3A or STT3B . These components work cooperatively to recognize appropriate substrate sequences and catalyze the glycan transfer reaction.

Each component of the OST complex contributes specific functionalities to the assembly. The STT3 proteins (either STT3A or STT3B) serve as the catalytic subunits, while other components like DAD-1 play essential structural and regulatory roles . The complex associates with other molecular assemblies, including the Sec61 complex or both the Sec61 and TRAP complexes, forming larger functional units that coordinate protein translocation and modification in the endoplasmic reticulum .

Protein-Protein Interactions

DAD-1 engages in numerous protein-protein interactions that mediate its biological functions. Based on STRING database analysis, DAD-1 shows strong functional partnerships with several proteins, particularly other components of the OST complex . The table below summarizes key protein interaction partners of DAD-1:

Protein PartnerDescriptionInteraction Score
RPN2Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 20.999
STT3BDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B0.999
RPN1Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1Not specified
Mcl-1Anti-apoptotic member of the Bcl-2 familyNot specified

RPN1 has been identified as essential for DAD-1 retention in the endoplasmic reticulum, highlighting the importance of this interaction for DAD-1's proper localization and function . The interaction with Mcl-1 suggests potential cross-regulation between different apoptotic pathways and may contribute to DAD-1's anti-apoptotic function .

Role in Cancer Biology

DAD-1's anti-apoptotic function has important implications for cancer biology, as resistance to apoptosis is a hallmark of cancer cells . Numerous studies have documented aberrant DAD-1 expression across various cancer types, with both upregulation and downregulation observed depending on the specific malignancy . The table below summarizes reported alterations of DAD-1 in different cancer types:

Cancer TypeDAD-1 Expression ChangeLevel of Alteration
Hepatocellular carcinomaIncreasedmRNA upregulated
Colorectal carcinomaIncreasedProtein upregulated
Small bowel carcinoid tumorIncreasedProtein upregulated
Prostate cancerIncreasedProtein upregulated
Cisplatin-resistant ovarian cancerIncreasedProtein and mRNA upregulated
Chronic lymphocytic leukemiaIncreasedProtein upregulated
Solid pseudopapillary tumor of pancreasDecreasedProtein downregulated
Invasive bladder cancerDecreasedmRNA downregulated

DAD-1 as a Biomarker

Emerging evidence suggests that DAD-1 may serve as a valuable biomarker for cancer diagnosis, prognosis, and treatment response prediction . In prostate cancer, DAD-1 expression levels gradually increase with disease progression, correlating with TNM grades and Gleason grades . Notably, serum DAD-1 has demonstrated superior specificity and sensitivity compared to prostate-specific antigen (PSA) in distinguishing between low and high Gleason grade prostate cancers . This finding highlights DAD-1's potential utility in improving prostate cancer stratification and management.

In addition to prostate cancer, DAD-1 has shown promise as a biomarker in other malignancies. For instance, in solid pseudopapillary tumor of the pancreas (SPTP), DAD-1 downregulation has been observed and may contribute to the characteristic features of this tumor type . Similarly, DAD-1 expression patterns in ovarian cancer appear to correlate with cisplatin resistance, potentially guiding treatment decisions .

DAD-1 Across Species

The DAD-1 protein exhibits remarkable conservation across diverse species, underscoring its fundamental importance in cellular function . Homologs of DAD-1 have been identified and characterized in numerous organisms, including:

  1. Drosophila melanogaster (fruit fly)

  2. Chlamydomonas (green algae)

  3. Mayetiola destructor (Hessian fly)

  4. Argopecten irradians (bay scallop)

  5. Chlamys farreri (Chinese scallop)

Functional studies in these diverse organisms have consistently demonstrated DAD-1's role in N-glycosylation and apoptosis regulation . For example, studies in Drosophila melanogaster have shown that DmDAD1 (Drosophila melanogaster DAD1) contributes to tissue enrichment, and its upregulation facilitates N-linked glycosylation . Loss of DmDAD1 leads to blocked N-linked glycosylation, accumulation of misfolded proteins, and enhanced endoplasmic reticulum stress, ultimately activating the Perk/Atf4 signaling pathway and triggering apoptosis .

Similarly, studies in Chlamys farreri have demonstrated that suppression of CfDAD1 (Chlamys farreri DAD1) results in increased cell apoptosis, while high mRNA expression levels are detected in immune tissues, suggesting a role in innate immunity . These cross-species findings highlight the conserved functional importance of DAD-1 in regulating fundamental cellular processes.

Research Applications

Recombinant DAD-1 serves as a valuable tool for investigating the protein's structure, function, and interactions. It enables detailed biochemical characterization, functional assays, and structural studies that would be challenging to perform with native protein isolated from tissues. Commercially available recombinant DAD-1 proteins, such as those derived from Mesocricetus auratus, provide researchers with standardized reagents for studying this important protein .

Specific research applications of recombinant DAD-1 include:

  1. Structure-function relationship studies

  2. Investigation of protein-protein interactions

  3. Development and validation of diagnostic assays

  4. Antibody production and characterization

  5. Drug discovery and screening

Therapeutic Potential

Given DAD-1's role in apoptosis regulation and its aberrant expression in various cancers, it represents a potential therapeutic target . In cancer types where DAD-1 is overexpressed, strategies to inhibit its expression or function might enhance apoptotic sensitivity and improve treatment outcomes. Conversely, in contexts where DAD-1 downregulation contributes to pathology, approaches to enhance its expression or activity might offer therapeutic benefits.

The development of recombinant DAD-1-based therapies or DAD-1-targeted interventions represents an area of ongoing research. As our understanding of DAD-1's functions and regulatory mechanisms continues to expand, new opportunities for therapeutic exploitation may emerge.

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand your specific needs. Please indicate any format preferences in your order remarks, and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
dad-1; F57B10.10; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1; Oligosaccharyl transferase subunit dad-1; Defender against cell death 1; Protein dad-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
dad-1
Target Protein Sequence
MAAQVVPVLSKLFDDYQKTTSSKLKIIDAYMTYILFTGIFQFIYCLLVGTFPFNSFLSGF ISTVTSFVLASCLRMQVNQENRSEFTAVSTERAFADFIFANLILHLVVVNFLG
Uniprot No.

Target Background

Function
Dad-1 is a subunit of the oligosaccharyl transferase (OST) complex, which catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This transfer constitutes the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally, and the OST complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits of the OST complex are required for maximal enzyme activity. Dad-1 exhibits cell death-inhibiting activity and suppresses certain forms of programmed cell death in *C. elegans*.
Database Links
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is DAD1 and what is its biological function?

DAD1 is an essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of high mannose oligosaccharides from lipid-linked oligosaccharide donors to asparagine residues within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This N-glycosylation process occurs cotranslationally as the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER) .

DAD1 has a dual function: maintaining the structural integrity of the OST complex for glycosylation and preventing apoptosis. Loss of the DAD1 protein has been demonstrated to trigger programmed cell death, indicating its importance not only for proper glycosylation but also for cell survival .

How does DAD1 integrate with the oligosaccharyltransferase (OST) complex?

DAD1 serves as a critical structural component of the OST complex. Within this complex, the catalytic activity involves the transfer of dolichyl diphosphooligosaccharide to protein L-asparagine, resulting in dolichyl diphosphate and a glycoprotein with the oligosaccharide chain attached by N-glycosyl linkage to protein L-asparagine .

The OST complex exists in different forms, but most contain at least RPN1, RPN2, OST48, DAD1, OSTC, KRTCAP2, and either STT3A or STT3B. The multiple components work cooperatively to recognize nascent polypeptides, identify appropriate glycosylation sites (Asn-X-Ser/Thr motifs), and catalyze the transfer of oligosaccharides . DAD1's integration within this complex is essential for both structural stability and catalytic function.

What are the optimal expression systems for recombinant DAD1?

When selecting an expression system for recombinant DAD1, researchers must consider the membrane-bound nature of this protein and its role in complex formation. Several expression systems can be evaluated:

  • Bacterial Expression Systems: While E. coli systems like the K4 strain used for other glycosyltransferases offer high yields, they often present challenges for membrane proteins like DAD1 . Membrane proteins frequently form inclusion bodies in bacterial systems and lack post-translational modifications.

  • Yeast Expression Systems: These provide advantages for membrane protein expression as they possess eukaryotic protein folding machinery and can perform some post-translational modifications.

  • Insect Cell Systems: The baculovirus expression system offers improved folding for complex membrane proteins and has been successfully used for components of glycosylation machinery.

  • Mammalian Expression Systems: These provide the most native-like environment for human DAD1 expression, offering proper folding, post-translational modifications, and membrane integration.

For structural studies and functional assays of DAD1, mammalian expression systems (such as HEK293 or CHO cells) typically yield the most physiologically relevant protein, though at lower yields than microbial systems .

What purification strategies are most effective for recombinant DAD1?

Purifying membrane proteins like DAD1 requires specialized approaches:

  • Membrane Extraction: Gentle detergents are crucial for solubilizing DAD1 while maintaining its native conformation. Small volumes of DAD1 recombinant protein may become entrapped in the seal of the product vial during shipment and storage, requiring careful handling .

  • Affinity Chromatography: Using tagged recombinant DAD1 (typically His, FLAG, or Strep-II tags) allows for specific capture. Sequential elution with increasing imidazole concentrations (10-40 mM) followed by elution with 250 mM imidazole can be effective for His-tagged proteins.

  • Size Exclusion Chromatography: This step is crucial for separating monomeric DAD1 from aggregates and ensuring sample homogeneity.

  • Alternative Approaches: For functional studies, reconstitution into nanodiscs or liposomes may better preserve activity compared to detergent solubilization.

Quality control should include SDS-PAGE with Western blotting using DAD1-specific antibodies, mass spectrometry for identity confirmation, and activity assays to verify functional integrity .

How can DAD1 activity be measured in vitro?

Measuring DAD1 activity presents challenges as it functions as part of the larger OST complex. Several approaches can be used:

  • Reconstitution Assays: Purified recombinant DAD1 can be combined with other OST components to reconstitute the complex in vitro. Glycosyltransferase activity can then be measured using radioisotope donor substrates similar to methods used for other glycosyltransferases . The catalytic activity to monitor is: dolichyl diphosphooligosaccharide + protein L-asparagine → dolichyl diphosphate + glycoprotein with N-glycosyl linkage .

  • Cell-Based Complementation Assays: Cell lines with DAD1 knockout or knockdown can be transfected with recombinant DAD1 variants, and restoration of glycosylation can be assessed using glycoproteomics or lectin binding assays.

  • Apoptosis Prevention Assays: Since loss of DAD1 triggers apoptosis, the ability of recombinant DAD1 to prevent programmed cell death in DAD1-deficient cells can serve as an indirect functional assay .

  • Binding Assays: Surface plasmon resonance or microscale thermophoresis can assess the binding of DAD1 to other OST components or to substrates.

For comprehensive assessment, combining multiple approaches provides more robust characterization of DAD1 functionality.

How does structure-function analysis inform glycosyltransferase engineering?

Structure-function analysis of glycosyltransferases like DAD1 provides crucial insights for enzyme engineering. Recent advances with other glycosyltransferases demonstrate how this approach can be applied to DAD1:

  • Docking-Guided Rational Engineering: As demonstrated with BsGT-1 (another glycosyltransferase), molecular docking combined with "hot spots" alanine scanning and site saturation mutagenesis can identify regions influencing substrate specificity . For DAD1, similar approaches could identify residues critical for OST complex assembly or substrate recognition.

  • Key Functional Regions: In BsGT-1, three major regions were found to significantly influence glycodiversification: the PSPG-like motif region, the C2 loop region, and the flexible N3 loop region . By analogy, identifying equivalent regions in DAD1 could guide targeted mutations to modify its activity or stability.

  • Translating Findings to Homologues: The "hot spots" identified in one glycosyltransferase often function similarly in homologous proteins . This principle could be applied to study DAD1 across different species or to engineer DAD1 variants with modified properties.

  • Biophysical Property Considerations: Modifications to glycosyltransferases can affect properties like water solubility, as seen with BsGT-1 engineered glycosides . This knowledge can guide DAD1 engineering for improved stability or solubility while maintaining function.

What role does DAD1 play in apoptotic pathways?

DAD1 (Defender against cell death 1) was originally identified for its anti-apoptotic properties, and its role in programmed cell death pathways is complex:

  • Glycosylation-Dependent Effects: The primary function of DAD1 in the OST complex is essential for proper N-glycosylation. Disruption of this process leads to accumulation of misfolded proteins in the ER, triggering ER stress and eventually apoptosis through the unfolded protein response (UPR) pathway .

  • Direct Anti-Apoptotic Functions: Beyond its role in glycosylation, DAD1 may have direct interactions with apoptotic machinery. Loss of DAD1 protein triggers apoptosis, suggesting it may regulate cell death pathways independently of its glycosylation function .

  • Experimental Approaches: To study DAD1's role in apoptosis, researchers can use:

    • CRISPR/Cas9 to generate conditional DAD1 knockout models

    • Domain-specific mutations to separate glycosylation and anti-apoptotic functions

    • Proteomics approaches to identify DAD1 interactors during apoptotic stress

    • Live-cell imaging with apoptotic markers in DAD1-depleted cells

  • Therapeutic Implications: Understanding DAD1's apoptotic functions has potential applications in cancer research, where modulating cell death pathways is a key therapeutic strategy .

How does Deep Adaptive Design methodology apply to DAD1 research?

Deep Adaptive Design (DAD) represents a cutting-edge approach that can significantly enhance DAD1 research efficiency:

  • Real-Time Experimental Optimization: Traditional sequential Bayesian experimental design approaches require substantial computation at each stage of an experiment, making them impractical for real-time decisions. Deep Adaptive Design addresses this by amortizing the cost of adaptive design, allowing experiments to be run in real-time . For DAD1 research, this could enable rapid optimization of expression conditions or mutagenesis strategies.

  • Network-Based Design Decisions: DAD employs a design network that takes data from previous experimental steps as input and outputs the next design using a single forward pass, enabling design decisions in milliseconds during live experiments . This approach could accelerate the identification of optimal conditions for DAD1 purification or functional assays.

  • Training with Contrastive Information Bounds: The DAD methodology introduces contrastive information bounds as suitable objectives for the sequential experimental setting . When applied to DAD1 research, this framework could help design more efficient screening approaches for identifying functional variants or optimal buffer conditions.

  • Customized Architecture Exploiting Symmetries: The DAD approach leverages customized network architecture that exploits key symmetries . This principle could be particularly valuable when studying the interaction of DAD1 with other OST complex components, where structural symmetries might inform protein-protein interface prediction.

How should data tables and charts be structured for DAD1 research?

Proper data presentation is critical for DAD1 research. Based on established reporting standards in glycosyltransferase and protein research:

  • Quantitative Data Presentation: Data should be presented in both tabular and graph forms with brief explanations of how to read the tables. Statistical measures of annual variability of several factors and statistical summaries should be included for comprehensive studies .

  • Institutional Classification: When reporting data across different research institutions, consider using established classification schemes (such as Carnegie Foundation categories) to organize results. Include the number of institutions and percentage distributions to contextualize findings .

  • Specialized Data Tables for DAD1: For DAD1-specific research, tables should include:

    • Enzyme kinetic parameters (Km, Vmax, kcat) for wild-type and mutant DAD1

    • Binding affinities with other OST components

    • Comparative activity across different expression systems

    • Effects of various detergents or lipids on stability and activity

  • Visualization Best Practices: Present comparative data in tables rather than lists, and use appropriate visualization methods (bar charts for discrete comparisons, line graphs for trends over conditions, scatter plots with regression for correlation analysis) .

  • Standardized Reporting: Include methodology details to enable reproducibility, clearly state statistical tests used, and provide both raw data and processed results when possible.

What are common pitfalls in recombinant DAD1 experiments?

Researchers working with recombinant DAD1 should be aware of several common challenges:

  • Protein Stability Issues: As a membrane protein, DAD1 can be unstable when removed from its native environment. Small volumes may become entrapped in the seal of product vials during shipment and storage . Maintain appropriate detergent concentrations throughout handling to prevent aggregation.

  • Expression and Purification Challenges: The yield of functional DAD1 can be low, especially in non-mammalian expression systems. Consider co-expressing with other OST components to improve stability and folding.

  • Activity Assessment Complications: Since DAD1 functions as part of a larger complex, isolated DAD1 may show little activity in vitro. Reconstitution with other complex components may be necessary for meaningful functional assays.

  • Structural Characterization Limitations: The small size and membrane nature of DAD1 present challenges for structural studies. Consider studying DAD1 within the larger OST complex context rather than in isolation.

  • Interpretation of Cross-Species Data: While DAD1 is highly conserved, subtle species-specific differences exist. Be cautious when extrapolating findings between organisms, particularly regarding interaction partners.

  • Reproducibility Concerns: Variation in lipid or detergent environment can significantly impact results. Document exact buffer compositions, detergent types and concentrations, and lipid content when reporting methods.

How can inconsistent results in DAD1 functional assays be reconciled?

When faced with contradictory or inconsistent results in DAD1 research, consider the following systematic approach:

  • Source Variation Analysis: Compare experimental conditions between studies, including protein source, expression system, and purification method. Evaluate whether full-length versus truncated constructs were used and consider species differences if proteins from different organisms were studied.

  • Methodological Assessment: Analyze differences in assay formats (in vitro vs. cellular, direct vs. indirect) and evaluate the sensitivity and specificity of different detection methods. Consider whether assays measure different aspects of DAD1 function or were performed under different temporal conditions.

  • Context-Dependent Function Hypothesis: Consider whether DAD1 function varies with cellular context, post-translational modifications, or the presence of different OST components. The catalytic activity of glycosyltransferases can be significantly influenced by experimental conditions, as observed with other enzymes in this class .

  • Data Integration Framework: Develop a model that accommodates seemingly contradictory results and identifies conditions under which different functions predominate. Use statistical approaches to weight evidence based on methodological strength.

  • Verification Experiments: Design experiments specifically targeting contradictory findings, including positive and negative controls validated in conflicting studies. Implement orthogonal methods to measure the same functional parameter.

  • Consideration of Protein Quality: Verify protein integrity by mass spectrometry, check for degradation using Western blotting, and assess proper folding using appropriate biophysical techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.