Recombinant Donkey ATP synthase protein 8 (MT-ATP8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
MT-ATP8; ATP8; ATPASE8; MTATP8; ATP synthase protein 8; A6L; F-ATPase subunit 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-67
Protein Length
full length protein
Species
Equus asinus (Donkey) (Equus africanus asinus)
Target Names
Target Protein Sequence
MPQLDTSTWFINIVSMILTLFIVFQLKISKHSYPMHPEAKTTKMAKRLTPWESKWTKIYSPLSLPQQ
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembranous catalytic core F1 and the membrane proton channel F0, linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a minor subunit of the F0 domain, located within the membrane alongside subunit a.
Database Links

KEGG: eai:808062

Protein Families
ATPase protein 8 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is MT-ATP8 and what is its functional significance in mitochondrial energy production?

MT-ATP8 (ATP synthase protein 8) is a small hydrophobic protein encoded by the mitochondrial genome that serves as an essential component of the F₀ sector of ATP synthase (Complex V). The protein consists of approximately 68 amino acid residues with a transmembrane domain and plays crucial roles in:

  • Assembly and stability of the ATP synthase complex

  • Coupling proton transport through F₀ to ATP synthesis in the F₁ sector

  • Facilitating conformational changes between F₀ and F₁ sectors during catalysis

The hydrophobic nature of amino acids in the transmembrane domain is particularly essential for coupling proton transport to ATP synthesis. The C-terminal region (containing approximately the last 14 amino acids) is highly conserved and critical for proper interaction with other subunits in the assembly of the F₀ sector .

How does MT-ATP8 structure compare between donkeys and other mammalian species?

While specific structural data for donkey MT-ATP8 is not directly provided in current literature, comparative analysis with other mammalian MT-ATP8 proteins reveals:

  • High protein homology exists across mammalian species including horse (the closest relative to donkey with well-characterized MT-ATP8)

  • The membrane-spanning domain structure is generally preserved across species despite variations in primary sequence

  • The C-terminal region shows higher conservation than other regions, reflecting its functional importance

This conservation pattern suggests that experimental approaches validated in other mammalian systems can likely be adapted for donkey MT-ATP8 studies with appropriate considerations for species-specific variations.

What expression systems are most suitable for recombinant donkey MT-ATP8 production?

Based on success with other species' MT-ATP8 expression:

Expression SystemAdvantagesLimitationsOptimal Applications
E. coli- High yield
- Cost-effective
- Rapid production
- Lacks post-translational modifications
- Protein folding challenges
- Inclusion body formation
- Structural studies
- Antibody production
- Interaction assays
Yeast (S. cerevisiae)- Eukaryotic folding machinery
- Well-established for mitochondrial proteins
- Validated for ATP synthase studies
- Lower yield than E. coli
- More complex cultivation
- Functional studies
- Mutation analysis
- Complementation assays
Mammalian cells- Native-like post-translational modifications
- Proper folding environment
- High cost
- Lower yield
- Technical complexity
- Functional characterization
- Interaction studies

What challenges are associated with expressing functional recombinant donkey MT-ATP8?

Several technical challenges must be addressed:

  • Hydrophobicity: The transmembrane domain of MT-ATP8 creates solubility challenges during expression and purification. Strategies to overcome this include:

    • Fusion with solubility-enhancing tags (such as His-tag used successfully with blue whale MT-ATP8)

    • Optimization of detergent conditions during protein extraction and purification

    • Development of membrane-mimetic environments for functional studies

  • Protein stability: MT-ATP8's small size and hydrophobic nature contribute to instability when expressed outside its native complex. Recommendations include:

    • Addition of 5-50% glycerol in storage buffers

    • Aliquoting for single use to avoid freeze-thaw cycles

    • Expression as part of minimal functional constructs with interacting partners

  • Functional assessment: Determining whether recombinant MT-ATP8 retains native functionality requires specialized approaches:

    • Co-expression with other ATP synthase components

    • Assembly assays using blue native polyacrylamide gel electrophoresis (BN-PAGE)

    • ATP synthase activity assays in reconstituted systems

How can researchers effectively model the impact of MT-ATP8 mutations on ATP synthase function?

Yeast S. cerevisiae provides an excellent model system for studying MT-ATP8 variants, as demonstrated by recent research . Key methodological approaches include:

  • Complementation studies: Introducing donkey MT-ATP8 variants into yeast strains with endogenous ATP8 deletions to assess functional rescue

  • Biochemical analysis: Isolating mitochondria to measure:

    • ATP synthesis rates

    • Membrane potential maintenance

    • Proton translocation efficiency

    • ATP synthase assembly using BN-PAGE

  • Structural modeling: Using available ATP synthase structures to predict impacts of mutations:

    • While primary sequences differ between species, the structural conservation in the membrane domain allows for meaningful modeling

    • Computational approaches can predict how specific residue changes affect interactions with other subunits

  • In vitro reconstitution: Combining purified components to assess direct functional impacts of variants

What is the relationship between MT-ATP8 and MT-ATP6, and how does this impact experimental design?

The relationship between MT-ATP8 and MT-ATP6 has significant implications for research:

  • Genomic overlap: MT-ATP8 and MT-ATP6 genes show a 46 nucleotide overlap in the mitochondrial genome , meaning that:

    • Mutations in the overlap region can affect both proteins

    • Experimental manipulations must account for potential dual effects

  • Functional interaction: MT-ATP8 interacts with MT-ATP6 during assembly and function:

    • MT-ATP8 assembly into the F₀ sector precedes and is required for proper MT-ATP6 incorporation

    • Y2H studies have shown direct interaction between DNAJC30 and MT-ATP6, with DNAJC30 also interacting with ATP synthase components including those that associate with MT-ATP8

  • Experimental considerations:

    • When designing expression constructs, researchers should consider whether to co-express both proteins

    • Mutations in the overlap region require careful assessment of which protein's function is primarily affected

    • Interaction studies should examine both proteins' assembly into the complex

What purification strategies yield the highest quality recombinant donkey MT-ATP8?

Based on successful approaches with other species:

  • Affinity chromatography:

    • N-terminal His-tag has proven effective for MT-ATP8 purification

    • Purification under native conditions requires careful detergent selection

    • Metal affinity chromatography (IMAC) with step gradients helps separate full-length protein from fragments

  • Recommended buffer conditions:

    • Tris/PBS-based buffers at pH 8.0 with 6% trehalose for stability

    • Addition of glycerol (5-50%) for long-term storage

    • Avoidance of repeated freeze-thaw cycles

  • Quality assessment:

    • SDS-PAGE with purity targets >90%

    • Mass spectrometry confirmation of full-length protein

    • Circular dichroism to verify secondary structure

  • Reconstitution:

    • Deionized sterile water at 0.1-1.0 mg/mL concentration for initial solubilization

    • Specialized detergents or lipid nanodisc technologies for maintaining native-like environment

How can researchers assess the functional integrity of recombinant donkey MT-ATP8?

Multiple complementary approaches are recommended:

  • Assembly assays:

    • Blue Native PAGE to visualize incorporation into ATP synthase complex

    • Immunoblotting to detect subcomplexes that may indicate assembly defects

    • Co-immunoprecipitation with antibodies against F₁ subunits of ATP synthase to confirm association

  • Functional assays:

    • In-gel ATP hydrolysis activity assays

    • Measurement of the mitochondrial energy-generating system (MEGS) capacity

    • Oxygen consumption rates in reconstituted systems

  • Structural verification:

    • Protease protection assays to confirm proper membrane topology

    • Cross-linking studies to verify interaction with known partners

    • Structural analysis using cryo-EM when incorporated into the larger complex

What cellular and animal models are most informative for studying donkey MT-ATP8?

Selection of appropriate models depends on research questions:

Model SystemAdvantagesLimitationsBest Applications
Yeast (S. cerevisiae)- Well-established for mitochondrial studies
- Genetic manipulation tools
- Validated for MT-ATP8 variant analysis
- Evolutionary distance from mammals
- Different metabolic requirements
- Initial mutation screening
- Basic functional characterization
- Structure-function relationships
Mammalian cell lines- Closer to native environment
- Suitable for tissue-specific effects
- Can use cybrid approaches
- Background mtDNA variation
- Limited to cellular phenotypes
- Tissue-specific effects
- Complex assembly analysis
- Interaction with mammalian-specific factors
Primary cells from donkeys- Native context
- Physiologically relevant
- Difficult to obtain
- Limited manipulation options
- Heteroplasmy considerations
- Validation of findings
- Species-specific characteristics
- Direct relevance to donkey biology
Cybrid cell models- Control of mtDNA background
- Allows testing of homoplasmic mutations
- Established methodology
- Artificial nuclear-mitochondrial combinations
- Limited to cellular phenotypes
- Specific mutation analysis
- Heteroplasmy studies
- Comparative analysis with human mutations

Researchers have successfully used cybrid models to confirm the pathogenicity of MT-ATP8 mutations identified in patients, demonstrating their utility for functional validation .

How should researchers approach the comparative analysis of MT-ATP8 across species to inform donkey-specific studies?

When conducting comparative analyses:

  • Sequence alignment strategies:

    • Focus on the functional domains, particularly the C-terminal region which shows higher conservation

    • Use multiple alignment tools to identify truly conserved residues versus alignment artifacts

    • Weigh conservation patterns by phylogenetic distance

  • Structural comparison:

    • Although primary sequences differ, the structural features of MT-ATP8 membrane domains are conserved across species

    • Use available structural data from mammals like bovine ATP synthase as templates

    • Compare equid species (horse) data when available as closest relatives to donkeys

  • Functional domain mapping:

    • Identify residues involved in interactions with other subunits

    • Compare transmembrane topology predictions across species

    • Evaluate conservation of residues in different functional domains

  • Interpretation framework:

    • Higher conservation suggests greater functional importance

    • Species-specific variations may reflect adaptations to metabolic demands

    • Consider coevolution with interacting partners, particularly MT-ATP6

What considerations are important when interpreting the impact of MT-ATP8 variants?

When analyzing variants:

  • Functional categorization:

    • Effects on protein stability/expression

    • Impacts on complex assembly

    • Alterations in proton coupling efficiency

    • Changes in catalytic activity

  • Molecular mechanism assessment:

    • Premature stop codons (like p.Trp55X) can result in truncated proteins lacking essential C-terminal regions

    • Conserved residue substitutions may affect interactions with other subunits

    • Mutations in the transmembrane domain may impact coupling between F₀ and F₁

  • Heteroplasmy considerations:

    • MT-ATP8 is encoded by mitochondrial DNA, which can exist in heteroplasmic states

    • Threshold effects must be considered when interpreting variant impacts

    • Complementation between wild-type and variant forms may occur

  • Tissue-specific effects:

    • Different tissues have varying energy demands and mitochondrial content

    • Neuronal tissue often shows enhanced sensitivity to ATP synthase defects

    • Consider cell-type specific expression of auxiliary factors

How can structural modeling enhance understanding of donkey MT-ATP8 variants?

Structural modeling approaches provide valuable insights:

  • Homology modeling pipeline:

    • Use solved ATP synthase structures as templates

    • Incorporate donkey-specific sequence variations

    • Validate models using energy minimization and Ramachandran analysis

  • Interaction analysis:

    • Model interfaces with MT-ATP6 and other F₀ components

    • Calculate binding energies for wild-type versus variant forms

    • Identify potential compensatory mutations

  • Molecular dynamics simulations:

    • Assess stability of variants in membrane environments

    • Evaluate effects on proton channel dynamics

    • Model conformational changes during catalytic cycle

  • Integration with experimental data:

    • Use experimental constraints to refine models

    • Test predictions through targeted mutagenesis

    • Identify potential sites for compensatory mutations

Recent research has successfully used this approach to analyze MT-ATP8 variants at the structural level, providing mechanistic insights into how specific mutations affect ATP synthase function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.