Recombinant Donkey ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Donkey ATP synthase subunit a (MT-ATP6) is a full-length mitochondrial protein (UniProt ID: P92480) expressed in E. coli with an N-terminal His tag for purification and detection . It corresponds to residues 1–226 of the donkey-derived MT-ATP6 gene, which encodes a hydrophobic subunit essential for proton translocation in ATP synthase .

Key Production Details

ParameterDescription
Host SystemEscherichia coli (E. coli)
TagN-terminal His tag
Catalog NumberRFL32552EF
Biological RoleFacilitates proton flow for ATP synthesis in mitochondrial oxidative phosphorylation

Pathogenic Variants and Biochemical Impact

Studies on human MT-ATP6 variants reveal the following effects, which inform research on recombinant donkey homologs:

VariantBiochemical DefectClinical Correlation
m.8993T>GReduced ATP synthesis, increased mitochondrial membrane potential Leigh syndrome, NARP syndrome
m.9176T>GImpaired proton pumping, normal ATP synthase assembly Neurogenic ataxia
m.9185T>CDecreased mitochondrial membrane potential, impaired CV assembly Spastic paraplegia
m.8909T>C20–30% reduced ATP synthesis in yeast models Multisystem mitochondrial disorder

Yeast Models for Functional Analysis

  • Recombinant MT-ATP6 analogs in yeast (Saccharomyces cerevisiae) demonstrate conserved functional roles:

    • Mutations like m.8950G>A (aVal-142Ile) and m.9025G>A (aGly-167Ser) reduce ATP synthesis by disrupting proton channel efficiency .

    • Blue native PAGE assays show intact ATP synthase dimer/monomer ratios in most mutants, suggesting stability despite functional deficits .

Applications in Biomedical Research

  1. Disease Mechanism Studies: Used to model mitochondrial disorders like NARP syndrome and Leigh syndrome by introducing pathogenic mutations .

  2. Drug Screening: Assays with recombinant MT-ATP6 help identify compounds that restore ATP synthesis in cells with OXPHOS defects .

  3. Structural Biology: Facilitates cryo-EM and X-ray crystallography studies to map proton translocation pathways .

Limitations and Future Directions

  • Heteroplasmy Challenges: Pathogenicity depends on mutant mtDNA load, complicating in vitro modeling .

  • Species-Specific Differences: Donkey MT-ATP6 may exhibit slight functional variations compared to human or yeast orthologs, requiring cross-validation .

  • Therapeutic Development: Gene-editing tools (e.g., CRISPR/Cas9) could leverage recombinant proteins to test mtDNA mutation corrections .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipment is required, please contact us in advance for arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and inherent protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
Full length protein
Species
Equus asinus (Donkey) (Equus africanus asinus)
Target Names
Target Protein Sequence
MNENLFASFATPTMMGLPIVILIIMFPSILFPSSNRLINNRLISIQQWLVQLTSKQMMTI HNNKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVFMGFRHK TKAALAHFLPQGTPIFLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLA LMDISPSTALITFIILILLTILEFAVAMIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, which is produced by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Database Links

KEGG: eai:808063

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its role in mitochondrial function?

MT-ATP6 is a mitochondrial DNA-encoded gene that produces the subunit a of the F0 sector of ATP synthase (Complex V). This protein plays a critical role in proton translocation across the inner mitochondrial membrane, which is essential for the rotary motion of the enzyme and subsequent ATP synthesis. The subunit contains transmembrane domains and interacts with the c-ring to form the proton channel . The MT-ATP6 protein contains a conserved arginine residue that is crucial for proton translocation during ATP synthesis . In donkeys, as in other mammals, MT-ATP6 is integral to oxidative phosphorylation and cellular energy production.

What are the common methods for producing recombinant MT-ATP6 proteins?

Recombinant MT-ATP6 production typically involves:

  • Expression Systems: E. coli is commonly used for MT-ATP6 expression, as seen with the Bos mutus grunniens MT-ATP6 . For donkey MT-ATP6, both prokaryotic (E. coli) and eukaryotic systems (yeast, insect cells) can be employed depending on research requirements.

  • Tagging Strategies: N-terminal or C-terminal tags (His, YFP-HA) facilitate purification and detection. The choice of tag position is critical as it may affect protein folding and function .

  • Vector Selection: Vectors with strong, inducible promoters are preferred for mitochondrial proteins.

  • Optimized Codon Usage: Since mitochondrial and nuclear genetic codes differ slightly, codon optimization is essential when expressing mitochondrial genes in bacterial or eukaryotic cytoplasmic systems.

  • Purification Protocols: Affinity chromatography (using His-tag) followed by size exclusion chromatography is standard for obtaining pure recombinant protein samples .

The recombinant proteins can be stored as lyophilized powder or in appropriate buffer conditions with glycerol to prevent freeze-thaw damage .

How can I effectively design allotopic expression studies with donkey MT-ATP6?

Allotopic expression (AE) studies with donkey MT-ATP6 require careful planning:

  • Construct Design:

    • Create nuclear-encoded versions of the mitochondrial MT-ATP6 gene with appropriate mitochondrial targeting sequences

    • Include a mitochondrial targeting sequence at the N-terminus of the recombinant protein

    • Optimize codon usage for nuclear expression

    • Consider adding epitope tags for detection while ensuring they don't interfere with targeting or function

  • Expression System Selection:

    • Mammalian cell lines or transgenic animal models are preferred for functional studies

    • For donkey MT-ATP6, horse cell lines may provide a compatible cellular environment

  • Validation Steps:

    • Confirm mitochondrial localization using fluorescence microscopy with tagged proteins

    • Assess integration into ATP synthase complex using blue native gel electrophoresis

    • Measure functional rescue by ATP synthesis assays in cells with depleted or mutated endogenous MT-ATP6

  • Functional Analysis:

    • Compare ATP synthesis rates between cells expressing wild-type and mutant versions

    • Measure oxygen consumption and reactive oxygen species production

    • Assess complex V assembly using BN-PAGE and immunoblotting

This approach has successfully generated mouse models for studying mtDNA mutations and could be adapted for donkey MT-ATP6 research .

What are the most reliable methods to assess MT-ATP6 incorporation into the ATP synthase complex?

Multiple complementary approaches should be used to confirm proper incorporation:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • Allows visualization of intact ATP synthase complexes

    • Can differentiate between monomeric (~600 kDa) and dimeric (1-1.2 MDa) forms

    • In-gel ATP hydrolysis activity assays confirm functional complex formation

  • Immunoprecipitation with Subunit-Specific Antibodies:

    • Use antibodies against known ATP synthase subunits to pull down the complex

    • Western blotting with anti-MT-ATP6 antibodies confirms incorporation

    • Alternatively, tag the recombinant MT-ATP6 and use tag-specific antibodies

  • Mass Spectrometry Analysis:

    • Liquid chromatography-mass spectrometry (LC-MS/MS) of purified ATP synthase complexes

    • Confirms the presence of MT-ATP6 peptides within the complex

    • Provides information on post-translational modifications

  • Functional Assays:

    • Measure ATP synthesis rates in isolated mitochondria or membrane preparations

    • Compare oxidative phosphorylation capacity between systems with and without the recombinant protein

    • Use specific inhibitors like oligomycin to confirm ATP synthase-specific activity

  • Transmitochondrial Cybrid Studies:

    • Generate cybrid cells containing donor mitochondria with the recombinant MT-ATP6

    • Assess functional integration through ATP production measurements

Using these methods in combination provides robust evidence of proper incorporation and functionality.

How can transmitochondrial cybrid studies be optimized for donkey MT-ATP6 research?

Transmitochondrial cybrid studies for donkey MT-ATP6 require specialized approaches:

  • Cell Line Selection:

    • Use ρ0 cell lines (lacking mtDNA) from closely related species (equine if available)

    • Human or mouse ρ0 cell lines can be used but may introduce nuclear-mitochondrial compatibility issues

    • Ensure recipient cells are completely devoid of endogenous mtDNA using PCR verification

  • Mitochondrial Donor Preparation:

    • Isolate platelets or cytoplasts containing donkey mitochondria with the MT-ATP6 variant of interest

    • Alternatively, use donkey cells expressing the recombinant MT-ATP6

    • Ensure high-quality mitochondrial preparations to improve fusion efficiency

  • Fusion Protocol Optimization:

    • Use polyethylene glycol (PEG) or electric pulse methods for fusion

    • Implement selection strategies to eliminate unfused ρ0 cells

    • Verify cybrid formation using species-specific mtDNA markers

  • Heteroplasmy Analysis:

    • Quantify the proportion of mutant versus wild-type MT-ATP6 using digital droplet PCR

    • Monitor heteroplasmy levels across multiple passages

    • Be aware that heteroplasmy levels may vary substantially across different tissue types, which could affect experimental results

  • Functional Assessment:

    • Measure basal respiration and ATP synthesis capacity

    • Assess reactive oxygen species generation

    • Examine complex V assembly using blue-native gel electrophoresis

    • Correlate functional parameters with heteroplasmy levels

The cybrid approach allows for isolation of the effects of MT-ATP6 variants from nuclear genetic backgrounds, providing valuable insights into pathogenic mechanisms.

What structural features of MT-ATP6 are essential for proper function, and how can these be assessed in recombinant proteins?

Critical MT-ATP6 structural features include:

  • Transmembrane Domains:

    • While yeast F0 subunit a typically contains 6 transmembrane domains, apicomplexan homologs may have only 3, suggesting functional flexibility in membrane topology

    • For donkey MT-ATP6, prediction algorithms suggest 5-6 transmembrane domains

    • Assess using:

      • Computational prediction (TMHMM, Phobius)

      • Selective permeabilization coupled with immunodetection

      • Cysteine scanning mutagenesis

  • Conserved Arginine Residue:

    • Critical for proton translocation

    • Highly conserved across species including T. gondii and mammals

    • Functional importance can be assessed through:

      • Site-directed mutagenesis followed by functional assays

      • Hydrogen/deuterium exchange mass spectrometry to evaluate dynamic interactions

  • Interfaces with Other Subunits:

    • Interaction with c-ring subunits forms the proton channel

    • Assessment methods:

      • Cross-linking studies followed by mass spectrometry

      • Cryo-electron microscopy of reconstituted complexes

      • Molecular dynamics simulations based on homology models

  • N- and C-terminal Domains:

    • May be involved in complex assembly and stability

    • Analyze using:

      • Truncation studies

      • Domain swapping between species

      • Protein-protein interaction assays

Assessment of these features in recombinant donkey MT-ATP6 would require a combination of biochemical, biophysical, and computational approaches, ideally validated by functional complementation studies.

How do mutations in MT-ATP6 affect ATP synthase assembly and function?

Mutations in MT-ATP6 can impact ATP synthase in multiple ways:

  • Complex V Assembly Defects:

    • Truncating mutations lead to multiple bands on blue-native gel electrophoresis, indicating impaired assembly

    • These defects may result from:

      • Altered interactions with other F0 subunits

      • Impaired incorporation into the membrane

      • Premature complex destabilization

  • Bioenergetic Consequences:

    • Reduced basal respiration

    • Decreased ATP synthesis capacity

    • Increased reactive oxygen species (ROS) generation

    • These effects correlate with mutation type and heteroplasmy levels

  • Tissue-Specific Effects:

    • Variable heteroplasmy levels across tissues influence the severity of functional defects

    • Tissues with high energy demands (brain, muscle, kidney) are particularly vulnerable

    • The threshold effect determines when symptoms become apparent

  • Compensatory Mechanisms:

    • Some mutations may trigger adaptive responses

    • Upregulation of alternative energy production pathways

    • Mitochondrial biogenesis increases to compensate for individual defective organelles

The manifestation of these defects depends on:

  • The specific mutation location and type

  • Heteroplasmy levels

  • Nuclear genetic background

  • Tissue-specific energy demands

  • Age and environmental factors

Understanding these mechanisms helps in developing targeted therapeutic approaches and interpreting experimental results from recombinant MT-ATP6 studies.

What experimental approaches best demonstrate the functional impact of MT-ATP6 variants?

To comprehensively assess functional impacts of MT-ATP6 variants:

  • ATP Synthesis Measurements:

    • Microscale oxygraphy to measure respiratory capacity

    • Luciferase-based ATP quantification assays

    • 31P-NMR spectroscopy for real-time ATP production monitoring

    • Correlation of ATP synthesis rates with mutation load

  • Proton Translocation Assays:

    • pH-sensitive fluorescent probes to measure proton movement

    • Patch-clamp electrophysiology of reconstituted membranes

    • These directly assess the primary function of MT-ATP6

  • Reactive Oxygen Species (ROS) Quantification:

    • Fluorescent indicators (DCF-DA, MitoSOX)

    • EPR spectroscopy for specific ROS identification

    • Increased ROS generation is a common consequence of MT-ATP6 dysfunction

  • Complex V Assembly and Stability:

    • Blue-native PAGE followed by in-gel activity assays

    • Pulse-chase experiments to assess turnover rates

    • Thermal shift assays to measure complex stability

    • Impaired assembly produces characteristic patterns on BN-PAGE

  • In Vivo Phenotypic Assessments:

    • Transgenic animal models expressing the variant

    • Behavioral and physiological testing (e.g., wire hang test, Rota-Rod evaluations)

    • Tissue-specific examinations (histology, electron microscopy)

  • Mitochondrial Membrane Potential Measurements:

    • Potentiometric dyes (TMRM, JC-1)

    • Single-cell microscopy to assess heterogeneity

    • Flow cytometry for population analysis

  • Compensatory Response Evaluation:

    • Transcriptomic analysis of nuclear-encoded mitochondrial genes

    • Metabolomic profiling to identify altered pathways

    • These provide insights into cellular adaptation mechanisms

A multi-parametric approach combining several of these methods provides the most comprehensive functional characterization of MT-ATP6 variants.

How does heteroplasmy influence the experimental design when studying MT-ATP6 mutations?

Heteroplasmy—the coexistence of wild-type and mutant mtDNA—creates unique experimental challenges:

  • Heteroplasmy Quantification Methods:

    • Digital droplet PCR for accurate mutation load determination

    • Next-generation sequencing for comprehensive mtDNA analysis

    • Pyrosequencing for targeted mutation quantification

    • These methods have different sensitivity thresholds and should be selected based on expected heteroplasmy levels

  • Tissue Variability Considerations:

    • Heteroplasmy levels vary substantially across different tissues

    • Research design should account for tissue-specific thresholds

    • Multiple tissue sampling may be necessary for comprehensive assessment

  • Threshold Effect Analysis:

    • Determine the critical heteroplasmy level at which biochemical defects appear

    • Establish the relationship between heteroplasmy and phenotypic severity

    • Create heteroplasmy titration experiments with defined mutant:wild-type ratios

  • Clonal Selection Issues:

    • Random genetic drift can alter heteroplasmy levels during cell division

    • Regular monitoring of heteroplasmy in cultured cells is essential

    • Single-cell derived clones with stable heteroplasmy may be preferred for consistent results

  • Experimental Controls:

    • Include multiple control lines with varying heteroplasmy levels

    • Use isogenic controls where possible

    • Consider nuclear background effects on heteroplasmy tolerance

  • Longitudinal Studies:

    • Track heteroplasmy changes over time

    • Correlate with functional parameters

    • Assess selection pressures acting on mutant mtDNA

Understanding these aspects is crucial for correct interpretation of experimental data and for developing accurate disease models using recombinant MT-ATP6 proteins.

What are the most promising therapeutic strategies targeting MT-ATP6 defects, and how can recombinant proteins advance these approaches?

Several therapeutic strategies show promise for MT-ATP6-related disorders:

  • Allotopic Expression (AE):

    • Nuclear expression of mitochondrially-targeted MT-ATP6

    • Has shown functional rescue in mouse models

    • Recombinant proteins can:

      • Optimize mitochondrial targeting sequences

      • Test different promoters for sustained expression

      • Evaluate protein stability and incorporation efficiency

      • Develop delivery methods for therapy

  • Mitochondrial Replacement Therapy:

    • Replacement of affected mitochondria with healthy donor mitochondria

    • Recombinant MT-ATP6 research contributes by:

      • Improving understanding of nuclear-mitochondrial compatibility

      • Developing assays to confirm successful mitochondrial function

      • Creating quality control metrics for donor mitochondria

  • Small Molecule Approaches:

    • Compounds that enhance ATP synthesis or reduce ROS

    • Recombinant protein applications:

      • High-throughput screening platforms using purified recombinant proteins

      • Structure-based drug design targeting specific MT-ATP6 interactions

      • Validation of hits in cellular and animal models

  • Gene Editing of mtDNA:

    • Direct correction of MT-ATP6 mutations in mitochondria

    • Recombinant protein contributions:

      • Development of mitochondrially-targeted nucleases

      • Creation of reporter systems to detect editing efficiency

      • Testing delivery methods for editing machinery

  • Metabolic Bypass Strategies:

    • Enhancing alternative energy production pathways

    • Recombinant protein research helps by:

      • Identifying cellular responses to MT-ATP6 dysfunction

      • Testing interventions that upregulate compensatory pathways

      • Developing biomarkers of therapeutic response

  • Heteroplasmy Shifting:

    • Selective elimination of mutant mtDNA

    • Recombinant protein applications:

      • Development of sequence-specific mtDNA targeting molecules

      • Testing heteroplasmy manipulation approaches in model systems

      • Establishing safety profiles for selective agents

These approaches represent a spectrum from direct correction to symptomatic management, with recombinant MT-ATP6 research providing essential tools for development and validation of each strategy.

What are the critical considerations when designing experiments to compare wild-type and mutant MT-ATP6 proteins?

Experimental design for comparing MT-ATP6 variants requires attention to several key factors:

  • Expression System Selection:

    • Prokaryotic systems (E. coli) are suitable for structural studies but may lack post-translational modifications

    • Mammalian expression systems better represent native conditions but have lower yields

    • Insect cell systems offer a compromise between yield and proper folding

    • Consider species compatibility when selecting expression systems for donkey MT-ATP6

  • Construct Design Variables:

    • Tag placement can significantly impact function - both N and C terminal tags have been successful

    • Inclusion of appropriate targeting sequences for mitochondrial import

    • Codon optimization for the chosen expression system

    • Careful design of linker sequences to minimize functional interference

  • Control Selection:

    • Include appropriate negative controls (empty vector, inactive mutants)

    • Use positive controls (known functional variants)

    • Consider including related ATP synthase subunits as specificity controls

  • Functional Equivalence Verification:

    • Confirm that recombinant wild-type protein behaves similarly to endogenous protein

    • Validate expression levels to ensure comparable concentrations between variants

    • Verify proper subcellular localization using imaging or fractionation techniques

  • Experimental Conditions:

    • Standardize temperature, pH, and ionic conditions across experiments

    • Consider physiological relevance of assay conditions

    • Account for potential differences in protein stability between variants

  • Quantification Methods:

    • Use multiple independent methods to assess each parameter

    • Ensure appropriate statistical power through adequate technical and biological replicates

    • Implement blinding procedures where applicable to reduce bias

  • Data Normalization Strategies:

    • Normalize to total protein or to other ATP synthase subunits

    • Consider using internal controls for variability in expression or purification

    • Standardize data collection parameters across experimental groups

Following these considerations ensures meaningful comparisons between wild-type and mutant MT-ATP6 variants, increasing the reliability and reproducibility of experimental findings.

What are the best approaches for studying MT-ATP6 interactions with other ATP synthase subunits?

Several complementary approaches can elucidate MT-ATP6 interactions:

  • Crosslinking Coupled with Mass Spectrometry:

    • Apply chemical crosslinkers to stabilize transient protein-protein interactions

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Identify interaction sites through detection of crosslinked peptides

    • This approach has successfully identified novel ATP synthase subunits in T. gondii

  • Co-immunoprecipitation Studies:

    • Tag MT-ATP6 or other subunits to enable pulldown experiments

    • Confirm interactions by western blotting or mass spectrometry

    • Compare interaction profiles between wild-type and mutant variants

    • YFP-HA tagging has been successfully used with ATP synthase subunits

  • Blue Native PAGE Analysis:

    • Preserve native protein complexes during electrophoresis

    • Detect subcomplex formation or assembly defects

    • Combine with second-dimension SDS-PAGE for subunit identification

    • This technique reveals both monomeric (~600 kDa) and dimeric (1-1.2 MDa) forms

  • Proximity Labeling Techniques:

    • APEX2 or BioID fusion proteins to identify proteins in close proximity

    • Time-resolved studies to capture dynamic assembly processes

    • Differential labeling between wild-type and mutant variants to identify altered interactions

  • Cryo-Electron Microscopy:

    • Structural visualization of intact ATP synthase complexes

    • Comparison of structures with and without MT-ATP6

    • Identification of conformational changes induced by mutations

  • FRET/BRET Analysis:

    • Label MT-ATP6 and potential interaction partners with fluorescent/bioluminescent tags

    • Measure energy transfer as indicator of proximity

    • Real-time monitoring of interactions in living cells

  • Yeast Two-Hybrid or Split-Protein Complementation:

    • Modified for membrane proteins using specialized systems

    • Systematic screening of potential interaction partners

    • Validation of specific interaction domains

Using multiple approaches provides convergent evidence for genuine interactions and helps distinguish direct from indirect associations, which is crucial for understanding the structural organization of ATP synthase and the consequences of MT-ATP6 mutations.

What purification strategies yield the highest activity for recombinant MT-ATP6 proteins?

Optimized purification strategies for functional MT-ATP6:

  • Membrane Protein Extraction:

    • Gentle detergent solubilization is critical

      • Digitonin preserves native interactions and complex integrity

      • n-Dodecyl β-D-maltoside (DDM) offers good solubilization with moderate disruption

      • Triton X-100 may be too harsh for maintaining activity

    • Salt concentration optimization to preserve protein-protein interactions

    • Addition of phospholipids to stabilize the protein during extraction

  • Affinity Chromatography Options:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Anti-HA affinity purification for HA-tagged constructs

    • ATP-agarose chromatography for activity-based purification

    • Optimize elution conditions to maintain protein structure:

      • Use imidazole gradients rather than step elution

      • Maintain physiological pH throughout purification

      • Include stabilizing agents (glycerol, specific lipids)

  • Size Exclusion Chromatography:

    • Separates monomeric and oligomeric forms

    • Removes aggregates that can interfere with activity assays

    • Provides information on complex formation

    • Buffer composition during SEC significantly impacts activity preservation

  • Ion Exchange Chromatography:

    • Useful as a polishing step

    • Separates differently charged variants or conformations

    • Must be optimized to avoid stripping essential lipids or cofactors

  • Storage Conditions for Maximal Stability:

    • Addition of 5-50% glycerol prevents freeze-thaw damage

    • Aliquoting to avoid repeated freeze-thaw cycles

    • Storage at -80°C for long-term stability

    • Consideration of specialized stabilizing additives:

      • Specific lipids that interact with MT-ATP6

      • ATP or ATP analogs to stabilize conformation

      • Reducing agents to prevent oxidation of critical thiols

  • Activity Preservation Strategies:

    • Reconstitution into liposomes or nanodiscs to provide lipid environment

    • Addition of other ATP synthase subunits to stabilize structure

    • Rapid processing to minimize time between cell disruption and final storage

These strategies should be empirically optimized for donkey MT-ATP6, as protein stability and activity can vary significantly between species and specific constructs.

How do MT-ATP6 proteins vary across species, and what can this tell us about structure-function relationships?

MT-ATP6 exhibits notable evolutionary patterns with functional implications:

  • Sequence Conservation Patterns:

    • The critical arginine residue for proton translocation is highly conserved across diverse species

    • Transmembrane domains show higher conservation than loop regions

    • Comparative analysis across species reveals:

      • Core functional domains with high conservation

      • Species-specific adaptations in regulatory regions

      • Convergent evolution in distantly related organisms

  • Structural Variations:

    • Transmembrane topology differences:

      • 6 transmembrane domains in yeast and mammals

      • Only 3 transmembrane domains in some apicomplexan parasites like T. gondii

      • Equids including donkeys likely maintain the 6-transmembrane domain structure

    • These variations suggest functional flexibility in achieving proton translocation

  • Functional Adaptation:

    • Thermophilic organisms show adaptations for protein stability at high temperatures

    • Cold-adapted species display increased flexibility in key regions

    • Adaptations to different bioenergetic demands across species

    • Correlation between MT-ATP6 structure and metabolic requirements

  • Co-evolution with Interacting Subunits:

    • Compensatory mutations maintain interfaces with other ATP synthase components

    • Evolution of novel subunits in some lineages (like the 20 novel subunits in T. gondii)

    • These patterns highlight essential interaction domains

  • Implications for Recombinant Protein Studies:

    • Species-specific requirements for functional reconstitution

    • Potential for chimeric proteins to identify functional domains

    • Insights for designing stable recombinant constructs

Comparative studies of donkey MT-ATP6 with other equids and mammals can provide valuable insights into structure-function relationships that can inform experimental design and interpretation of functional data.

What can we learn from comparing recombinant MT-ATP6 to native protein in terms of structure and function?

Comparative analysis of recombinant and native MT-ATP6 reveals important insights:

  • Post-translational Modification Differences:

    • Native MT-ATP6 may contain modifications absent in recombinant systems

    • Potential modifications include:

      • Phosphorylation affecting protein-protein interactions

      • Acetylation influencing protein stability

      • Oxidative modifications related to ROS exposure

    • These differences can be mapped using mass spectrometry

  • Lipid Environment Effects:

    • Native protein exists in the specialized lipid environment of the inner mitochondrial membrane

    • Recombinant protein function can be significantly affected by:

      • Cardiolipin content of reconstitution membranes

      • Membrane fluidity and thickness

      • Presence of specific lipid microdomains

    • Functional differences may reflect lipid-protein interactions rather than intrinsic protein properties

  • Structural Conformations:

    • Recombinant proteins may adopt different conformational equilibria

    • Native state stabilization depends on:

      • Interactions with other subunits of the ATP synthase complex

      • Proton motive force across the membrane

      • Oligomeric state (monomer vs. dimer)

    • Structural comparison using hydrogen-deuterium exchange or limited proteolysis can reveal these differences

  • Functional Parameters:

    • Catalytic efficiency comparisons between native and recombinant systems

    • Proton translocation coupling efficiency

    • Inhibitor sensitivity profiles

    • These parameters help validate the physiological relevance of recombinant systems

  • Protein-Protein Interaction Networks:

    • Native MT-ATP6 participates in extensive interaction networks

    • Recombinant systems may lack accessory proteins that modulate function

    • Complementation studies in depleted systems can identify missing factors

Understanding these differences is crucial for interpreting experimental results with recombinant proteins and for developing more physiologically relevant experimental systems.

How can evolutionary conservation data guide the design and interpretation of MT-ATP6 mutation studies?

Evolutionary conservation analysis provides valuable guidance for MT-ATP6 research:

  • Identification of Critical Functional Domains:

    • Highly conserved residues across diverse species likely represent essential functional sites

    • Conservation mapping reveals:

      • The critical arginine residue involved in proton translocation

      • Residues forming the interface with the c-ring

      • Structural motifs maintaining protein folding

    • Mutations in these regions are more likely to be pathogenic

  • Prediction of Mutation Impact:

    • Mutations in highly conserved regions typically have greater functional consequences

    • Evolutionary constraint metrics (GERP, PhyloP scores) correlate with pathogenicity

    • Conservation patterns across different taxonomic levels provide nuanced predictions:

      • Mammalian-specific conservation suggests functions related to warm-blooded metabolism

      • Pan-eukaryotic conservation indicates core ATP synthase functions

  • Natural Experiment Insights:

    • Natural sequence variations that have been tolerated during evolution

    • Species with natural polymorphisms at sites of human pathogenic mutations

    • These represent natural experiments that can inform therapeutic approaches

  • Compensatory Mechanism Identification:

    • Co-evolving residue networks highlight:

      • Potential compensatory mutations that maintain function

      • Structural interdependencies within the protein

      • Interaction interfaces with other subunits

    • These patterns can guide mutagenesis strategies and interpretation

  • Experimental Design Guidance:

    • Focus functional studies on evolutionarily significant regions

    • Design mutations that test evolutionary hypotheses

    • Create chimeric proteins based on evolutionary divergence patterns

    • Develop control mutations in non-conserved regions

  • Cross-Species Validation:

    • Test whether equivalent mutations have similar effects across species

    • Identify species-specific contexts that modify mutation outcomes

    • Leverage natural genetic variation to understand mutation penetrance

Applying these evolutionary insights to donkey MT-ATP6 research enhances the biological relevance of experimental designs and improves the predictive power of mutation studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.