Recombinant Donkey Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during manufacturing.

The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize its development.

Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
Full length protein
Species
Equus asinus (Donkey) (Equus africanus asinus)
Target Names
Target Protein Sequence
MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISSMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLTFDS YMIPTSDLKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLVASRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEEWSASML
Uniprot No.

Target Background

Function

Recombinant Donkey Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation through three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1 – a binuclear center (BNC) formed by heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Gene References Into Functions
  1. Consider the potential roles of COX-2 when prescribing COX-2-selective inhibitors for horses with gastric ulcers. PMID: 21034322
Database Links

KEGG: eai:808064

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is cytochrome c oxidase subunit 2 and what is its role in cellular respiration?

Cytochrome c oxidase subunit 2 (MT-CO2) is one of the core components of mitochondrial cytochrome c oxidase (CCO), the terminal enzyme complex in the electron transport chain. It contains a dual-core CuA active site that plays a crucial role in electron transfer from cytochrome c to the catalytic center in subunit 1 . MT-CO2 specifically transfers electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 . This electron transfer is essential for maintaining the proton gradient across the inner mitochondrial membrane, which drives ATP synthesis. MT-CO2 is encoded by mitochondrial DNA and represents a rate-limiting enzyme in electron transfer .

What are the key functional domains in MT-CO2?

The key functional domains in MT-CO2 include:

  • CuA binding domain: Critical for binding the copper ions that facilitate electron transfer

  • Transmembrane domains: Allow proper anchoring in the inner mitochondrial membrane

  • Cytochrome c docking site: Facilitates interaction with the electron donor

  • Subunit I interaction interface: Enables proper assembly within the cytochrome c oxidase complex

These domains are highly conserved across species due to their essential functions in the electron transport chain and energy metabolism .

What expression systems are optimal for recombinant donkey MT-CO2?

The E. coli expression system has been successfully employed for recombinant MT-CO2 production. Specifically:

  • Expression vector: pET-32a has proven effective for MT-CO2 expression, providing a fusion tag system that aids in solubility and purification .

  • E. coli strain: Transetta (DE3) cells are suitable for expression of this mitochondrial protein .

  • Induction conditions: IPTG induction (typically 0.5-1.0 mM) at reduced temperatures (16-25°C) can improve protein folding and solubility .

For proper protein folding and functional studies, it's essential to ensure the recombinant protein contains the full sequence (amino acids 1-227 for donkey MT-CO2) .

What purification strategies yield high-quality recombinant MT-CO2?

A systematic purification approach includes:

  • Affinity chromatography: His-tagged recombinant MT-CO2 can be efficiently purified using Ni²⁺-NTA agarose affinity chromatography .

  • Buffer optimization: Tris/PBS-based buffers with pH 8.0 maintain stability during purification .

  • Storage stabilization: Addition of 6% trehalose to storage buffers helps maintain protein integrity .

  • Reconstitution protocol: Reconstitution in deionized sterile water to concentrations of 0.1-1.0 mg/mL, followed by addition of glycerol (final concentration 5-50%) for long-term storage at -20°C/-80°C .

This approach typically yields protein with >90% purity as determined by SDS-PAGE, with final concentrations around 50 μg/mL for the fusion protein .

How can functional activity of purified recombinant MT-CO2 be assessed?

Functional activity of recombinant MT-CO2 can be assessed through:

  • Spectrophotometric assays: UV-spectrophotometer analysis can measure the protein's ability to catalyze the oxidation of its substrate cytochrome c .

  • Infrared spectrometer analysis: This can detect structural changes upon substrate binding and catalysis .

  • Enzymatic activity assays: Measuring the rate of electron transfer from reduced cytochrome c.

Evidence from similar proteins indicates that tag-free MT-CO2 demonstrates functional activity, suggesting proper folding of the recombinant protein .

How can recombinant donkey MT-CO2 be utilized in evolutionary and comparative studies?

Recombinant donkey MT-CO2 provides valuable opportunities for evolutionary studies:

  • Sequence comparison: Multiple sequence alignment of MT-CO2 from different species can reveal evolutionary relationships, as demonstrated in studies with other species like the giant panda .

  • Phylogenetic analysis: MT-CO2 sequences can be used to construct phylogenetic trees that illuminate evolutionary relationships within Equidae and across mammals .

  • Adaptive evolution studies: Analysis of synonymous versus non-synonymous substitutions can identify potential selective pressures on MT-CO2 in different ecological niches, particularly relevant given donkeys' adaptation to diverse environments .

Such studies are particularly valuable given the ecological significance of donkeys as both domesticated and free-roaming species across various habitats .

What experimental protocols are recommended for structure-function studies?

For structure-function relationship studies:

  • Site-directed mutagenesis: Strategic modification of key residues can elucidate functional domains. For example, mutations in copper-binding sites can reveal their role in electron transfer.

  • Molecular docking: Computational approaches can predict interactions with substrates and inhibitors. For instance, allyl isothiocyanate (AITC) has been found to interact with specific residues like Leu-31 in similar proteins .

  • Spectroscopic analysis: Circular dichroism and fluorescence spectroscopy can monitor structural changes upon substrate binding.

A combination of these approaches provides comprehensive insights into structure-function relationships of MT-CO2.

How can recombinant MT-CO2 contribute to mitochondrial disease research?

Recombinant MT-CO2 can advance mitochondrial disease research through:

  • Model system development: Creating in vitro models of MT-CO2 variants associated with mitochondrial disorders.

  • Functional assessment: Comparing wild-type and mutant protein activities to understand pathological mechanisms.

  • Drug screening platforms: Using recombinant proteins to identify compounds that might restore function in defective variants.

These applications are particularly relevant given that defects in COX2 are associated with mitochondrial disorders affecting cellular energy metabolism .

What strategies address challenges in expressing membrane-associated proteins like MT-CO2?

The membrane-associated nature of MT-CO2 presents several expression challenges:

ChallengeSolution StrategyRationale
Protein insolubilityUse of fusion partners (His-tag)Enhances solubility and facilitates purification
Improper foldingLower induction temperature (16-20°C)Slows expression rate, allowing proper folding
Toxicity to host cellsControlled expression using tightly regulated promotersPrevents accumulation of toxic levels of protein
Low yieldCodon optimization for E. coliImproves translation efficiency in heterologous system

These strategies have demonstrated success in expressing functional MT-CO2 in bacterial systems, as evidenced by active recombinant protein production .

How can interactions between MT-CO2 and other respiratory complex components be studied?

Investigating protein-protein interactions within the respiratory complex requires:

  • Co-immunoprecipitation: Using antibodies against MT-CO2 to pull down interacting partners .

  • Proximity labeling: Techniques like BioID or APEX2 can identify proteins in close proximity to MT-CO2 in the native environment.

  • Cryo-EM studies: High-resolution structural analysis of entire respiratory complexes can position MT-CO2 in its functional context.

  • Cross-linking mass spectrometry: Identifies specific interaction sites between MT-CO2 and other subunits.

These methods collectively provide insights into the structural organization and functional relationships within the respiratory chain complexes.

What implications do MT-CO2 polymorphisms have for energy metabolism research?

MT-CO2 polymorphisms provide valuable insights for energy metabolism research:

  • Adaptive metabolism: Studies in other species like the giant panda have shown that MT-CO2 evolution may be linked to metabolic adaptations, such as the panda's ability to sustain energy needs despite a low-energy bamboo diet .

  • Neutrality testing: Analyses can determine whether MT-CO2 has undergone conservation or positive selection during evolution, as demonstrated in giant panda studies showing conservation throughout evolution .

  • Haplotype analysis: Identification of MT-CO2 haplotypes (as seen in giant pandas where three point mutations defined three haplotypes) can reveal population genetic structure and evolutionary history .

These approaches can elucidate how genetic variations in MT-CO2 contribute to metabolic adaptations in different environments and dietary regimes.

How can researchers address protein misfolding during recombinant expression?

When encountering protein misfolding:

  • Optimize expression temperature: Lowering temperature to 16-20°C during induction slows protein synthesis, allowing more time for proper folding.

  • Adjust induction conditions: Reducing IPTG concentration can decrease expression rate, potentially improving folding.

  • Co-express chaperones: Additional molecular chaperones can assist proper folding of complex proteins.

  • Use solubility enhancers: Addition of glycerol, sucrose, or specific amino acids to culture media can improve protein solubility and folding.

Successful expression of functional MT-CO2 has been achieved using these approaches, yielding protein capable of catalyzing the oxidation of cytochrome c .

What steps should be taken when enzymatic activity is lower than expected?

When encountering reduced enzymatic activity:

  • Verify protein integrity: Check for proteolytic degradation using SDS-PAGE and Western blotting .

  • Assess copper incorporation: Ensure proper incorporation of copper ions, essential for electron transfer function.

  • Optimize reaction conditions: Systematically adjust pH, temperature, and ionic strength to identify optimal conditions.

  • Evaluate substrate quality: Ensure cytochrome c substrate is properly reduced for activity assays.

  • Remove inhibitory contaminants: Additional purification steps may be necessary to remove inhibitors.

Spectrophotometric assays can confirm catalytic activity by measuring the oxidation of cytochrome c substrate, which should be affected by known modulators like allyl isothiocyanate in properly functioning protein .

How can researchers validate antibody specificity for MT-CO2 studies?

For validating antibody specificity:

  • Western blot analysis: Should reveal a band at 23-26 kDa corresponding to MT-CO2 .

  • Positive controls: Use samples with confirmed MT-CO2 expression (e.g., HepG2 cells) .

  • Cross-reactivity testing: Evaluate reactivity across species (known cross-reactivity with human, mouse, and rat samples should be considered) .

  • Immunofluorescence validation: Proper subcellular localization (mitochondrial pattern) confirms specificity .

  • Knockdown controls: Reduced signal in MT-CO2 knockdown samples confirms specificity.

For optimal results in immunofluorescence applications, titration of antibody dilutions (1:50-1:500) is recommended to determine optimal concentration for specific experimental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.