Recombinant Donkey NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Respiration

As a core subunit of Complex I, MT-ND3 facilitates electron transfer from NADH to ubiquinone (CoQ10), driving proton translocation across the mitochondrial inner membrane . Key mechanistic features include:

  • Catalytic Activity: Binds to the hydrophobic core of Complex I, stabilizing the transmembrane domain essential for proton pumping .

  • Pathogenic Relevance: Mutations in MT-ND3 are linked to mitochondrial disorders like Leigh syndrome and Leber’s hereditary optic neuropathy (LHON) .

Research Applications

This recombinant protein is primarily utilized in:

  • Structural Studies: Mapping conformational changes in Complex I during electron transfer .

  • Disease Modeling: Investigating pathogenicity of MT-ND3 mutations in neurodegenerative disorders .

  • Antibody Production: Serving as an antigen for generating isoform-specific antibodies .

Research Findings and Clinical Correlations

Studies using recombinant MT-ND3 have revealed:

  • Leigh Syndrome Link: The p.Thr101Pro mutation disrupts proton channel function, correlating with ATP synthesis deficits .

  • Parkinson’s Disease Associations: Oxidative damage to MT-ND3 exacerbates neuronal apoptosis in dopaminergic pathways .

  • Evolutionary Conservation: The donkey isoform shares 89% sequence homology with human MT-ND3, enabling cross-species mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which customers can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of your desired tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
Full length protein
Species
Equus asinus (Donkey) (Equus africanus asinus)
Target Names
Target Protein Sequence
MNLMLTLLTNTLLASLLVLIAFWLPQLNIYAEKTSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWASQTTNLNTMLIMALILISLLAISLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This subunit is essential for the catalytic activity of complex I.
Database Links

KEGG: eai:808060

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of MT-ND3 in mitochondrial physiology?

MT-ND3 serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This protein is essential for the catalytic activity of complex I and plays a critical role in mitochondrial energy production through oxidative phosphorylation. MT-ND3 enables NADH dehydrogenase (ubiquinone) activity and is involved in the critical step of mitochondrial electron transport from NADH to ubiquinone . The protein's function is highly conserved across species, suggesting that recombinant donkey MT-ND3 would perform similar core functions in the electron transport chain as observed in humans and other mammals.

How does MT-ND3 contribute to mitochondrial complex I assembly and stability?

MT-ND3 is essential for the proper assembly and catalytic activity of complex I. Research has shown that mutations in MT-ND3 can lead to failure in forming functional complexes in the mitochondrial respiratory chain . The protein's structural integrity is critical for maintaining the electron transfer capabilities of complex I. When studying recombinant donkey MT-ND3, researchers should consider that even minor alterations in the protein sequence could significantly impact complex I stability. Methodologically, researchers can assess complex I assembly using blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by immunoblotting with antibodies against various complex I subunits to determine if recombinant MT-ND3 properly incorporates into the complex.

How conserved is the MT-ND3 gene sequence across mammalian species, and what implications does this have for donkey MT-ND3 research?

The MT-ND3 gene is highly conserved across mammalian species, reflecting its essential role in cellular respiration. When examining conservation patterns, researchers should focus on critical functional domains, particularly those associated with catalytic activity. Based on studies in other species, donkey MT-ND3 likely shares significant sequence homology with equine relatives and other mammals. Comparative genomic analysis using multiple sequence alignment tools can reveal conserved domains that are essential for function versus regions that may exhibit species-specific variations. The high conservation suggests that findings from human MT-ND3 studies may have translational implications for donkey MT-ND3 research, particularly regarding structure-function relationships .

Which single nucleotide polymorphisms (SNPs) in MT-ND3 are most significant for functional variation, and how might they affect expression systems?

Several functionally significant SNPs have been identified in MT-ND3 across species. In studies of altitude adaptation, SNPs including m.10073C>T have shown positive associations with high-altitude adaptation (p < 0.0006), while others (m.9893 A>G, m.9932 A>C, and m.10155 C>T) demonstrated negative associations (p < 0.003) . When designing recombinant expression systems for donkey MT-ND3, researchers should consider these potential variation sites. Methodologically, site-directed mutagenesis can be employed to introduce specific SNPs to study their functional consequences. The choice of expression system should account for proper post-translational modifications and membrane insertion capabilities, as MT-ND3 is a membrane-bound protein. Researchers should verify whether codon optimization for the chosen expression system is necessary for efficient translation of donkey MT-ND3.

What are the optimal expression systems for producing functional recombinant donkey MT-ND3?

When expressing recombinant MT-ND3 from any species, researchers face significant challenges due to its hydrophobic nature and mitochondrial localization. For donkey MT-ND3, potential expression systems include:

  • Bacterial systems: E. coli-based systems may require optimization with fusion partners (such as MBP or SUMO) to improve solubility and prevent inclusion body formation.

  • Mammalian mitochondrial expression: Based on therapeutic approaches with human MT-ND3, researchers have designed specialized delivery systems like MITO-Porter that can target recombinant mRNA to mitochondria . This approach allows for expression of the protein in its native environment.

  • Cell-free systems: These may allow production of the membrane protein without toxicity issues often encountered in living cells.

Methodological considerations should include codon optimization for the chosen expression system, incorporation of purification tags that minimally impact protein function, and validation of proper folding and activity. Researchers should verify proper complex I incorporation using BN-PAGE and measure NADH:ubiquinone oxidoreductase activity to confirm functionality of the recombinant protein.

What protocols have proven most effective for quantifying MT-ND3 mutation rates in heteroplasmic samples?

For quantifying mutation rates in MT-ND3, particularly in heteroplasmic samples, the amplification refractory mutation system (ARMS)-quantitative PCR has proven effective. This approach allows for precise detection of specific point mutations with high sensitivity . The methodology involves:

  • Careful primer design with mismatches at the 3' terminal side to detect specific point mutations

  • Optimization of quantitative PCR conditions

  • Creation of standard curves using known mixtures of wild-type and mutant sequences

  • Calculation of mutation rates using appropriate formulas

When developing this methodology for donkey MT-ND3, researchers should:

  • Design primers specific to donkey MT-ND3 sequence

  • Validate the method using synthetic templates with known mutation frequencies

  • Ensure high specificity by testing against closely related sequences

  • Establish a reliable quantification range with appropriate controls

The ARMS-PCR method has been successfully used to detect the mutation rate of human mtDNA and could be adapted for donkey MT-ND3 research with appropriate species-specific modifications .

How do MT-ND3 mutations contribute to mitochondrial diseases, and what are the implications for using donkey MT-ND3 in model systems?

MT-ND3 mutations have been associated with several mitochondrial diseases, including Leigh syndrome, Mitochondrial Complex I Deficiency, and Leber hereditary optic neuropathy . The m.10191T>C and m.10158T>C mutations in MT-ND3 have been specifically linked to Leigh syndrome with epilepsy, with a high incidence of Lennox-Gastaut syndrome observed in patients with the m.10191T>C mutation .

When using donkey MT-ND3 in model systems, researchers should consider:

  • The conservation of disease-associated residues between human and donkey MT-ND3

  • The heteroplasmy levels required to produce phenotypic effects (studies show median mutant loads of 82.5% in Leigh syndrome patients)

  • The specific cellular consequences of MT-ND3 mutations (complex I assembly failure, altered ROS production, compromised ATP synthesis)

Methodologically, CRISPR-based approaches for introducing specific mutations or patient-derived cybrid cell lines incorporating donkey mitochondria could provide valuable model systems for studying these disease mechanisms.

What therapeutic strategies targeting MT-ND3 have shown promise, and how might they be applied to donkey models?

Innovative therapeutic approaches targeting MT-ND3 mutations include mitochondrial mRNA delivery strategies. Research has demonstrated the potential of delivering wild-type MT-ND3 mRNA to mitochondria in diseased cells using specialized delivery systems like MITO-Porter . This approach aims to decrease the mutation rate of mRNA in affected mitochondria.

Key methodological considerations for such therapies include:

  • mRNA design modifications: The therapeutic mRNA may require modifications from the native sequence, such as changing the start codon from ATA to ATG and adding polyA tails to enhance translation efficiency .

  • Delivery system optimization: MITO-Porter systems have shown promising results for mitochondrial targeting, with cellular uptake efficiency comparable to empty vectors .

  • Quantification of therapeutic effect: Researchers have evaluated heteroplasmy levels using ARMS-quantitative PCR and measured functional improvements through mitochondrial respiration assays .

When adapting these approaches to donkey models, species-specific sequence considerations and potential differences in mitochondrial import machinery should be evaluated. The therapeutic potential of such approaches could extend to equine mitochondrial disorders or serve as models for human disease treatments.

How does MT-ND3 genetic diversity contribute to environmental adaptation, and what insights might donkey MT-ND3 provide?

MT-ND3 genetic diversity has been linked to environmental adaptation, particularly in high-altitude environments. Studies in Tibetan yaks and cattle have shown that specific SNPs and haplotypes in MT-ND3 are associated with high-altitude adaptation. For example, haplotypes H1 and H5 in MT-ND3 showed positive associations with high-altitude adaptability (p < 0.0014), while haplotype H3 was negatively associated .

These findings suggest that MT-ND3 variations may represent evolutionary adaptations to environmental stressors, particularly hypoxic conditions. Studying donkey MT-ND3 could provide valuable insights into:

  • Adaptation mechanisms in equids exposed to various environmental conditions

  • Comparative respiratory efficiency across related species

  • Evolutionary selection pressures on mitochondrial genes

Methodologically, researchers could employ population genetics approaches to analyze MT-ND3 sequence variations across donkey populations from different geographic regions and altitudes. Functional studies comparing respiratory efficiency and ROS production under normal and stressed conditions could reveal the physiological implications of these genetic variations.

What are the most significant differences between human MT-ND3 and donkey MT-ND3, and how do these impact experimental design?

While the search results don't provide direct comparative data between human and donkey MT-ND3, extrapolation from comparative studies suggests several considerations:

  • Sequence variations: Despite high conservation of functional domains, species-specific variations likely exist, particularly in non-catalytic regions.

  • Protein interactions: Differences may exist in how MT-ND3 interacts with other subunits of complex I, potentially affecting assembly dynamics.

  • Regulatory elements: Variations in regulatory elements controlling MT-ND3 expression could impact experimental design, particularly for gene expression studies.

When designing experiments with donkey MT-ND3:

  • Antibody selection should account for potential epitope differences

  • PCR primers should target conserved regions when possible

  • Expression systems should be evaluated for compatibility with donkey MT-ND3 codon usage

  • Functional assays should consider potential differences in optimal reaction conditions

Researchers should conduct thorough sequence alignments between human and donkey MT-ND3 to identify critical differences before designing experiments, ensuring that methodologies account for these species-specific variations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.