Recombinant Dopamine receptor 3 (dop-3)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Genetic Basis

DRD3 is encoded by the DRD3 gene located on chromosome 3q13.31 in humans. Its protein structure comprises seven transmembrane helices, intracellular carboxyl termini, and extracellular amino termini, typical of GPCRs . The recombinant form often includes tags (e.g., mEGFP) for tracking and purification .

Species-Specific Gene and Protein Information

SpeciesChromosomal LocationGene SymbolProtein Length (AA)Uniprot ID
Human3q13.31DRD3400P35462
Mouse16 28.44 cMDrd3446P30728
Rat11q21Drd3446P19020
Source: IUPHAR/BPS Guide to PHARMACOLOGY

Functional and Pharmacological Research

Recombinant DRD3 has been instrumental in studying:

  • Dimerization Dynamics: Antagonists like spiperone and haloperidol destabilize DRD3 dimers, promoting monomerization .

  • Ligand Selectivity: D3R-preferring agonists (e.g., pramipexole) and antagonists (e.g., SB-277011-A) show 80x selectivity over D2R .

  • Neuroprotective Effects: Activation reduces α-synuclein aggregation and enhances BDNF secretion, mitigating Parkinson’s disease (PD) pathology .

Parkinson’s Disease (PD)

  • DRD3 activation elevates striatal dopamine, reduces neuroinflammation, and slows neurodegeneration .

  • Biomarker Potential: Elevated DRD3 mRNA in peripheral blood correlates with preclinical PD stages .

Schizophrenia and Addiction

  • DRD3 antagonists (e.g., GSK-598809) attenuate drug-seeking behavior in preclinical models .

  • Partial agonists (e.g., cariprazine) show efficacy in improving cognitive deficits .

Experimental Tools and Antibodies

Recombinant DRD3 is widely used to generate research tools:

  • Antibodies: Anti-DRD3 antibodies (e.g., ab42114) validate receptor expression via Western blot, IP, and ICC/IF .

  • Cell Models: Stable HEK293 lines expressing tagged DRD3 enable high-throughput ligand screening .

Future Directions

  • Biased Agonism: Developing ligands that selectively activate neuroprotective vs. motor pathways.

  • Gene Therapy: Targeting DRD3 polymorphisms (e.g., Ser9Gly) to personalize PD treatment .

Recombinant DRD3 remains a pivotal tool for unraveling dopamine signaling mechanisms and advancing therapeutics for neurological disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate with us and we will prioritize development of the specified tag.
Synonyms
dop-3; CBG10841; Dopamine receptor 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-604
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
dop-3
Target Protein Sequence
MLTGQHHIPGIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVILSVYRERNLQTVTNMLI VSLAVSDLFVAIGVMSFGVYYEWNGFKWGLGSFFCHVYQALDVACSTASILNLLAISLDR YIAIGHPISYAQYGARGGRAMISITIVWGVSCAVALPLLLGVNPMENDQCELANPWFNMI SSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK HFKNRTDQILLEISFQTSSFPTISESSDDGSTISPMINSFNNFLPKKSQYPSTLIPAIPE CGSMPNLTIIERPAPPEKEKDIELSIMDLHDTVEMLDDKYTSAMITRSFGEELEEILPFI DGSTSVKNSREQLHATRSNTSTTRLLDVKPELRSISVPSIQDEKKMNSRPPENPFAHQNG TNKQRLLPNPGILMKSKSTTLLKTNGYLDTDSLNNNRNSHKKSTADLLPNDDYSFTDSMR VYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFI LHLSNSICLVIDSNSDCIGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGF FKKR
Uniprot No.

Target Background

Function
Dopamine receptor 3 (dop-3) is a receptor for dopamine. Its activity is mediated by G proteins that activate adenylyl cyclase. In terms of antagonist responses, it is classified within the D2-like dopamine receptor group. It mediates the effect of dopamine on the inhibition of locomotion and acts as an antagonist of dop-1.
Database Links

STRING: 6238.CBG10841

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of dopamine receptor D3 and how does it function?

Dopamine receptor D3 (DRD3) is a G protein-coupled receptor encoded by the DRD3 gene in humans. It belongs to the D2-like receptor subfamily (which includes D2, D3, and D4 receptors). The D3 receptor primarily couples to inhibitory G-proteins (predominantly Go proteins) and inhibits adenylyl cyclase, consequently reducing cAMP levels . While DRD3 displays remarkably high binding affinity for dopamine (100-fold higher than D2R or D1R), it exhibits lower signaling efficacy compared to D2 receptors .

The receptor possesses complex dynamics with transmembrane domains that undergo conformational rearrangements upon agonist binding, particularly in the TM6 region. This structural change allows G-protein or arrestin binding to its intracellular surface . Beyond cAMP signaling, D3 receptor activation can stimulate MAPK kinase pathways, activate GIRK channels, and inhibit P/Q-type calcium channels, with both adenylyl-cyclase inhibition and ERK phosphorylation involving Gβγ subunits .

How does dopamine receptor D3 distribution vary across the brain?

Dopamine receptor D3 shows specific regional distribution patterns that vary somewhat across species but maintain consistent high-expression areas. In rats, the highest levels of D3R expression are found in:

  • Islands of Calleja

  • Nucleus accumbens

  • Olfactory tubercle

  • Substantia nigra

  • Ventral tegmental area

In the human brain, D3R is most densely expressed in:

  • Globus pallidus

  • Ventral striatum

  • Putamen

  • Caudate nuclei

While moderate expression occurs in:

  • Prefrontal cortex (laminated pattern in principal cells)

  • Anterior cingulate cortex

  • Various subcortical regions including thalamic nuclei, amygdala, and hippocampus

Interestingly, immunocytochemical studies have revealed that all dopaminergic neurons in the substantia nigra pars compacta and ventral tegmental area express D3 receptors, confirming its role as an autoreceptor .

What approaches are most effective for detecting and measuring dopamine receptor D3 expression?

Several complementary techniques have proven effective for quantifying and localizing D3 receptors:

  • Receptor Autoradiography:

    • Using agonist ligands: [³H]7-OH-DPAT or [³H]PD-128907

    • Using antagonist ligands: [¹²⁵I]epidepride

  • In Situ mRNA Hybridization:

    • Effective for mapping regional expression patterns

    • Can identify specific neuronal populations expressing D3R

  • PET Imaging:

    • [¹¹C]-(+)-PHNO (a D3 receptor-preferring agonist) enables quantification in living brain

    • Shows high signal in substantia nigra, globus pallidus, putamen, and caudate regions

    • Limited utility in cortical regions due to low signal-to-noise ratio

  • Immunocytochemistry/Immunofluorescence:

    • Requires carefully validated antibodies

    • Can be combined with other markers (e.g., TH) for colocalization studies

    • Critical consideration: antibody specificity must be validated using recombinant receptors and D3R-deficient mice

How can researchers generate and validate antibodies against dopamine receptor D3?

Generating specific antibodies against D3R requires careful consideration of sequence uniqueness and rigorous validation:

  • Antibody Generation Strategy:

    • Select peptide sequences specific to D3R that do not share homology with other dopamine receptors

    • Use synthetic peptides from these unique sequences as immunogens

  • Validation Requirements:

    • Test antibody against recombinant D3R expressed in cell lines

    • Confirm absence of reactivity in tissues from D3R-deficient mice

    • Compare immunolabeling pattern with known distribution of D3R mRNA and binding sites

    • Evaluate concordance between different detection methods (e.g., immunofluorescence vs. immunoperoxidase)

  • Important Considerations:

    • Previous D3R antibodies have shown discrepancies between immunolabeling and known mRNA/binding site distributions

    • Double-labeling with markers of dopaminergic neurons (e.g., tyrosine hydroxylase) can confirm cellular specificity

    • Microscopic examination at multiple magnifications is essential for accurate interpretation

What evidence supports dopamine receptor D3's role as an autoreceptor?

Multiple lines of evidence confirm D3R functions as an autoreceptor regulating dopamine neuron activity:

  • Anatomical Evidence:

    • Immunofluorescence studies demonstrate that all tyrosine hydroxylase (TH)-positive cells in the substantia nigra pars compacta and ventral tegmental area display D3R immunoreactivity

    • D3R mRNA is expressed in substantia nigra and VTA

  • Functional Evidence:

    • D3R stimulation inhibits dopamine release and synthesis

    • Dopamine levels in the nucleus accumbens and striatum are twice as high in D3R-deficient mice compared to wild-type mice

    • Agonists with preference for D3R inhibit dopamine release, synthesis, and neuronal electrical activity

  • Regulatory Mechanisms:

    • D3R mRNA in SN/VTA strongly decreases after lesion of dopamine neurons

    • This decrease could reflect direct loss in dopaminergic neurons or changes in non-dopaminergic neurons deprived of factors like BDNF

How does dopamine receptor D3 contribute to Parkinson's disease pathology?

Dopamine receptor D3 plays multiple roles in Parkinson's disease mechanisms and treatment:

  • Neuroprotective Functions:

    • D3R agonists decrease alpha-synuclein (α-Syn) aggregation via Lewy bodies inclusion, a pathogenic signature exclusively present in PD patients

    • D3R activation elevates dopamine content by inhibiting dopamine reuptake and breakdown

    • D3R stimulation enhances brain-derived neurotrophic factor (BDNF) secretion

    • These mechanisms collectively ameliorate neuroinflammation, reduce oxidative stress, and promote neurogenesis in the nigrostriatal pathway

  • Compensatory Changes in PD:

    • Striatal D3R density increases in PD, likely reflecting compensatory changes upon dopaminergic denervation

    • Nigral D3R density is reduced in PD with dementia, reflecting neuronal loss in the nigrostriatal system

  • Therapeutic Relevance:

    • D3R agonists show antidepressant effects in rodent models, addressing non-motor symptoms

    • Compounds like pramipexole prevent cell apoptosis and restore damaged neural networks

    • Rotigotine helps attenuate hyperpyrexia syndrome and schizophrenia symptoms in PD patients

    • D3R mutations can predict PD age of onset and treatment prognosis

What challenges exist in developing selective ligands for dopamine receptor D3?

Developing D3R-selective compounds faces several significant obstacles:

  • Structural Homology:

    • High amino acid sequence homogeneity across dopamine receptor subtypes creates challenges in developing subtype-selective agonists

    • The D2 and D3 receptors share particularly high structural similarity in their orthosteric binding sites

  • Binding vs. Signaling Selectivity:

    • D3R shows high binding affinity for dopamine but lower signaling efficacy compared to D2R

    • A compound may show binding selectivity without functional selectivity

  • Complex Receptor Dynamics:

    • D3R, like other GPCRs, possesses highly complex dynamics with multiple conformational states

    • D3R can trigger different intracellular signaling pathways via biased agonism

    • Secondary (allosteric) binding sites can influence signaling in distinct manners

  • Validation Challenges:

    • Limited availability of truly selective tools to validate target engagement in vivo

    • Difficulty in separating D2R vs. D3R effects in complex behavioral models

How do dopamine receptor D3 agonists affect molecular pathways in neurodegenerative disorders?

D3R agonists modulate multiple neuroprotective pathways relevant to neurodegenerative conditions:

  • Alpha-synuclein Regulation:

    • D3R agonists decrease alpha-synuclein aggregation via Lewy bodies

    • They regulate α-Syn aggregation and clearance mechanisms

  • Neurotrophic Factor Enhancement:

    • D3R stimulation enhances brain-derived neurotrophic factor (BDNF) secretion

    • BDNF promotes neuronal survival and plasticity pathways

  • Anti-inflammatory Actions:

    • D3R activation ameliorates neuroinflammation

    • Reduces pro-inflammatory cytokine production

  • Oxidative Stress Reduction:

    • D3R agonists alleviate oxidative stress

    • Enhance antioxidant defense mechanisms

  • Neurogenesis Promotion:

    • D3R stimulation promotes neurogenesis in the nigrostriatal pathway

    • May contribute to circuit repair and functional recovery

  • Receptor Interactions:

    • D3R interacts with other dopamine receptors (particularly D1R)

    • These interactions contribute to reduction of PD-associated motor symptoms

What signaling mechanisms distinguish dopamine receptor D3 from other dopamine receptor subtypes?

D3R exhibits several unique signaling characteristics:

  • G-protein Coupling Preferences:

    • D3R couples predominantly to inhibitory Go proteins

    • Despite structural similarities to D2R, D3R shows differences in G-protein coupling efficiency

  • Signaling Efficacy Profile:

    • D3R displays high binding affinity for dopamine but lower signaling efficacy compared to D2R

    • This creates a unique pharmacological profile where occupancy doesn't directly correlate with functional effects

  • Downstream Pathway Activation:

    • Beyond cAMP inhibition, D3R activation stimulates MAPK pathways

    • Activates GIRK channels and inhibits P/Q-type calcium channels

    • Both adenylyl-cyclase inhibition and ERK phosphorylation involve Gβγ subunits

  • Biased Signaling Capacity:

    • D3R can exhibit biased agonism, where different ligands preferentially activate distinct signaling pathways

    • Allosteric binding sites influence signaling in distinct manners

  • Receptor Dynamics:

    • D3R undergoes specific conformational changes upon activation

    • Most significant rearrangements occur in the intracellular site, especially in the TM6 region

What animal models are most appropriate for studying dopamine receptor D3 function?

Different model systems offer complementary advantages for D3R research:

  • Rodent Models:

    • Rats and mice show similar D3R distribution patterns with highest levels in islands of Calleja, nucleus accumbens, and caudate nuclei

    • Mice display higher hippocampal D3R expression and lower frontal cortex expression compared to other species

    • D3R knockout mice exhibit altered dopamine levels (twice as high in nucleus accumbens and striatum)

  • Non-human Primates:

    • Rhesus monkeys show strong D3R mRNA expression in layer 5 pyramidal neurons within the prefrontal cortex

    • In baboons, highest D3R-PHNO binding is found in SN-VTA, globus pallidus, putamen, and caudate regions

  • Behavioral Paradigms:

    • D3R agonists disrupt prepulse inhibition of startle (PPI) in animal models

    • Rodent depression models show antidepressant effects of D3R agonists like 7-OH-DPAT, pramipexole, and rotigotine

  • Disease Models:

    • Parkinson's disease models allow evaluation of D3R's role in motor symptoms and neurodegeneration

    • Addiction models can assess D3R involvement in reward and reinforcement pathways

How can researchers effectively generate and utilize recombinant dopamine receptor D3?

Successful generation and application of recombinant D3R requires attention to several methodological aspects:

  • Expression Systems:

    • Mammalian cell lines (HEK293, CHO) provide native-like post-translational modifications

    • Insect cells can yield higher protein quantities for structural studies

    • Consideration of membrane composition is critical for proper receptor folding and function

  • Construct Design:

    • Codon optimization for expression host

    • Addition of tags (FLAG, His) for purification and detection

    • Careful selection of signal sequences for proper membrane targeting

  • Functional Validation:

    • Ligand binding assays to confirm proper folding and pharmacology

    • G-protein coupling assays (GTPγS binding, cAMP inhibition)

    • Calcium mobilization or ERK phosphorylation assays to assess signaling

  • Applications:

    • Screening platform for novel selective ligands

    • Structural studies (requires stabilization of the receptor)

    • Investigation of signaling mechanisms in controlled cellular environments

    • Antibody validation control

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.