Recombinant Draba nemorosa Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Draba nemorosa (Woodland whitlowgrass)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KIVRKEKGGYEITIVDPSNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what is its function in plant systems?

Apocytochrome f is the protein product of the plastid petA gene that functions as a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. In Draba nemorosa (woodland whitlowgrass), this protein facilitates electron transfer between photosystems during photosynthesis. The mature protein spans amino acids 36-320 of the full sequence and contains domains characteristic of c-type cytochromes .

What are the structural specifications of the recombinant Draba nemorosa Apocytochrome f protein?

The recombinant form of this protein has the following specifications:

ParameterSpecification
Amino Acid Range36-320 (mature protein)
Expression SystemE. coli
TagN-terminal His-tag
FormLyophilized powder
Amino Acid SequenceYPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQVLANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPGQKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIISKIVRKEKGGYEITIVDPSNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGDAEIVLQDPLRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLSEMNF
Purity>90% (SDS-PAGE verified)

The protein contains characteristic domains required for electron transport function and heme coordination .

How does Draba nemorosa Apocytochrome f differ from homologs in other plant species?

Draba nemorosa belongs to the yellow whitlow-grass family, which is characterized by small annual plants that grow on dry hillsides and rock outcrops . While specific comparative data on petA across multiple species is limited in the provided sources, research on plastome microevolution suggests that there are both conserved regions essential for function and variable regions that may indicate evolutionary adaptation. The petA gene has been identified in multiple plant species, with variations in non-coding regions that may provide insights into plant evolutionary relationships .

What is the optimal protocol for reconstituting lyophilized recombinant Apocytochrome f?

For optimal reconstitution of lyophilized Draba nemorosa Apocytochrome f:

  • Centrifuge the vial briefly before opening to ensure the product is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (recommended default is 50%)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

What storage conditions maximize stability of the recombinant protein?

Storage PurposeRecommended Condition
Short-term (≤1 week)4°C
Long-term-20°C or -80°C
BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Special ConsiderationsAvoid repeated freeze-thaw cycles
Reconstituted ProteinAdd 5-50% glycerol (final concentration)

Multiple freeze-thaw cycles significantly reduce protein stability and functionality, so proper aliquoting upon reconstitution is essential .

How can researchers use this recombinant protein to study plant plastid evolution?

Researchers can use recombinant Apocytochrome f to:

  • Compare sequences with homologs from other species to identify conserved functional domains

  • Investigate the role of direct and inverted repeats in plastid gene evolution

  • Study perfect direct repeat insertions (PDRIs) that occur frequently in plastome microevolution

  • Analyze the patterns of conservation in coding versus non-coding regions

  • Examine post-translational modifications that might differ across species

Research indicates that perfect direct repeat insertions are common elementary events in the microevolution of plastomes, with repeated word lengths typically around 5 base pairs .

What methods can be used to verify proper folding and functionality of the recombinant protein?

To verify structural integrity and functionality:

  • Use circular dichroism (CD) spectroscopy to assess secondary structure

  • Perform UV-visible spectroscopy to confirm characteristic absorption peaks of properly incorporated heme

  • Conduct size exclusion chromatography to verify the monomeric state and absence of aggregation

  • Measure electron transfer capability using appropriate redox partners

  • Compare spectroscopic properties with native cytochrome f isolated from plant material

How can researchers integrate findings from in vitro studies with this protein to in vivo photosynthetic research?

Integration approaches include:

  • Generate antibodies against the recombinant protein for immunolocalization studies in plant tissues

  • Design mutant versions based on in vitro findings for expression in model plant systems

  • Use the recombinant protein to identify interaction partners that can be validated in vivo

  • Compare kinetic parameters measured in vitro with photosynthetic efficiency in plants

  • Use structural insights to interpret the effects of natural mutations found in plant populations

What approaches can be used to investigate the evolutionary significance of direct repeats in the petA gene region?

Building on findings that perfect direct repeat insertions are common in plastome evolution:

  • Compare petA gene sequences across diverse plant species to identify conserved versus variable repeat regions

  • Analyze the distribution of repeat lengths, with special attention to the common 5-bp repeats found in plastomes

  • Implement computational models to assess whether repeat insertions result from replication errors

  • Investigate whether repeats in the petA gene occur preferentially in specific regions (e.g., between petA and psbJ, where 50-bp repeats have been identified in Onagraceae)

  • Determine if repeat frequency correlates with evolutionary distance between species

What methods are most effective for studying protein-protein interactions involving Apocytochrome f?

For studying protein-protein interactions:

  • Use the His-tag on the recombinant protein for pull-down assays with potential interaction partners

  • Apply Surface Plasmon Resonance (SPR) to measure binding kinetics and affinity

  • Conduct crosslinking studies followed by mass spectrometry to identify interaction interfaces

  • Perform Microscale Thermophoresis (MST) to detect interactions based on changes in thermophoretic mobility

  • Create fluorescently labeled versions for Förster Resonance Energy Transfer (FRET) experiments

How can site-directed mutagenesis of the recombinant protein help understand electron transport mechanisms?

Site-directed mutagenesis studies can:

  • Identify essential residues in the amino acid sequence by systematic mutation and functional testing

  • Target conserved regions in the 285-amino acid mature protein to assess their role in electron transport

  • Modify potential interaction sites to study their impact on binding to other components of the photosynthetic apparatus

  • Create variants that mimic natural polymorphisms observed across plant species

  • Investigate the role of specific domains in stability, heme incorporation, and redox potential

What are common challenges when working with recombinant Apocytochrome f and how can they be addressed?

ChallengePotential Solution
Loss of activity during storageStore with glycerol (5-50%) and avoid repeated freeze-thaw cycles
Protein aggregationUse fresh preparations and optimize buffer conditions
Incomplete heme incorporationVerify spectroscopic properties and consider in vitro heme reconstitution
Non-specific binding due to His-tagUse imidazole in binding buffers or consider tag removal for certain applications
Poor solubilityAdjust buffer conditions or use fusion protein systems

How should researchers interpret discrepancies between in vitro findings with the recombinant protein and in vivo observations?

When discrepancies arise:

  • Consider that the recombinant protein lacks the native membrane environment of the thylakoid

  • Evaluate whether post-translational modifications present in vivo are absent in the E. coli-expressed protein

  • Assess if the His-tag affects functionality in specific assays

  • Examine whether protein-protein interactions differ in the reconstituted system versus the native context

  • Consider the impact of experimental conditions (pH, ionic strength, temperature) that may differ from physiological conditions

How does the research on direct repeats in plastomes inform our understanding of the petA gene evolution?

Studies on direct repeats in plant plastomes have revealed:

  • Perfect direct repeat insertions are common elementary events in the microevolution of plastomes and mitochondria

  • The repeated word length is typically around 5 base pairs, though longer repeats exist

  • Single-base insertions are the most common type (4,642 cases documented in one study)

  • Insertions of repeats longer than 24 bp are rare, with only a few cases of 26, 27, 29, 30, 35, 50, 51, and 78 bp reported

  • These findings suggest that instant emergence of direct repeat insertions results from replication errors leading to duplications of non-coding DNA regions

What can be learned from comparing the structure and function of Apocytochrome f across different plant families?

Comparative analysis can reveal:

  • Conservation patterns that indicate functionally critical regions of the protein

  • Variations that might correlate with environmental adaptations in different species

  • Evidence of convergent or divergent evolution in photosynthetic electron transport systems

  • Whether structural variations affect the efficiency or regulation of electron transport

  • Insights into the relationship between sequence conservation and protein function across the evolutionary spectrum

This type of analysis is particularly valuable when studying proteins like Apocytochrome f from Draba nemorosa, a small annual plant with specific habitat requirements (dry hillsides, often by rock outcrops) that may have adapted its photosynthetic apparatus to these conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.