Recombinant Draba nemorosa Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Research Applications

cemA serves as a tool for studying chloroplast biology:

ApplicationMethodOutcome
ProteomicsMass spectrometry (MS) to map envelope protein networks.Identification of transport complexes .
Localization StudiesImmunoblotting or GFP-tagging to confirm envelope localization.Validation of subcellular targeting .
Cross-Species AnalysisComparative genomics to infer conserved CEM functions.Synteny analysis in Brassicaceae .

Comparative Analysis with Other cemA Orthologs

The Draba nemorosa cemA shares structural features with orthologs from green algae and red algae:

SpeciesLength (AAs)TagSource
Nephroselmis olivacea 392His-tagE. coli
Cyanidium caldarium PartialUndisclosedBaculovirus
Draba nemorosa 229UndisclosedE. coli

Key Differences:

  • Sequence Length: Varies due to species-specific insertions/deletions.

  • Expression Yields: Full-length proteins from E. coli are more common than partial fragments .

Challenges and Future Directions

  • Low Abundance: Native cemA is rare, necessitating recombinant production for functional studies .

  • Structural Complexity: Hydrophobic regions complicate crystallization for X-ray crystallography.

  • Functional Gaps: Direct evidence for cemA’s role in Draba nemorosa remains unexplored; studies in model organisms (e.g., Arabidopsis) could guide hypotheses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Draba nemorosa (Woodland whitlowgrass)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFFYFTSIVFLPWVISLCCNKSLKIWITNWWNTRQCETFLNDIKEKSVLEKF IQLENLFQLDEMIKEYPETDLQQFRLGIHKETIQFIKIHNEYHIHTILHFSTNLISFVIL SGYSFWGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure of the cemA gene in Draba nemorosa chloroplast genome?

The cemA gene in Draba nemorosa is located in the large single-copy (LSC) region of the chloroplast genome, which is typical for members of the Brassicaceae family. While specific sequence details for D. nemorosa cemA are not completely characterized in the literature, comparative analysis with close relatives in the Brassicaceae family indicates that the gene is highly conserved. The chloroplast genome of Draba nemorosa, like other Brassicaceae members, has a GC content of approximately 36.4%, which is relatively consistent across the family . The gene encodes for the chloroplast envelope membrane protein that plays a crucial role in chloroplast function and carbon dioxide uptake.

What is known about the expression pattern of cemA in Draba nemorosa through development?

Expression of cemA in Draba nemorosa follows patterns typical of chloroplast genes, with highest expression levels occurring during active photosynthetic growth. The gene shows upregulation during leaf development as chloroplasts mature, coinciding with the April to July growing season when D. nemorosa actively flowers and photosynthesizes . The expression is likely coordinated with other chloroplast genes involved in photosynthesis and carbon fixation, though specific expression profiles for cemA in D. nemorosa have not been comprehensively documented across all developmental stages.

What purification strategies overcome the challenges of working with the hydrophobic domains in recombinant cemA protein?

Purification of recombinant cemA presents significant challenges due to its hydrophobic membrane-spanning domains. Successful purification protocols typically employ:

Purification StepRecommended ApproachCritical Parameters
SolubilizationMild detergents (DDM, LDAO, or digitonin)Detergent concentration: 1-2% for extraction, 0.05-0.1% for maintaining solubility
Initial CaptureIMAC with His6-tagpH 8.0, low imidazole wash (10-20 mM), elution with 250-300 mM imidazole
Secondary PurificationSize exclusion chromatographyUse detergent-compatible columns with buffers containing 0.05% detergent
ConcentrationSpecialized membrane protein concentratorsAvoid typical centrifugal concentrators that bind hydrophobic proteins

The critical step involves maintaining the native-like environment during purification to preserve the structural integrity and function of cemA. Amphipols or nanodiscs have shown promise for stabilizing membrane proteins like cemA during downstream characterization experiments.

How can researchers effectively analyze the evolutionary selection pressures on cemA in Draba nemorosa compared to other Brassicaceae members?

To analyze evolutionary selection pressures on cemA, researchers should:

  • Construct a comprehensive dataset of cemA sequences from multiple Brassicaceae species, including Draba nemorosa, Arabis stellari, and other related species.

  • Calculate the ratio of non-synonymous to synonymous substitutions (Ka/Ks ratio) across different lineages. Similar approaches examining chloroplast genes like ndhA between Arabis species have revealed values above 1.0 (specifically 1.35135 between certain Arabis species), indicating positive selection .

  • Utilize branch-site models in software packages like PAML to identify specific amino acid sites under selection and determine if selection is directional or relaxed.

  • Compare cemA selection patterns with other chloroplast genes. Research on other chloroplast genes across 11 plant families has identified specific genes like rbcL showing positive selection across multiple lineages .

  • Correlate selection patterns with environmental adaptations, as cemA function may relate to carbon acquisition efficiency in different habitats where Draba nemorosa grows (ranging from Alaska to Arizona and across Canada) .

What are the functional implications of recombinant cemA protein in thylakoid membrane reconstitution experiments?

Recombinant Draba nemorosa cemA plays a crucial role in thylakoid membrane reconstitution experiments, particularly regarding carbon concentration mechanisms. When incorporated into artificial membrane systems or isolated thylakoid preparations, recombinant cemA facilitates:

  • CO₂ uptake across the membrane, potentially enhancing carbon fixation efficiency in reconstituted systems.

  • Maintenance of pH gradients necessary for photosynthetic electron transport, working in coordination with other membrane proteins.

  • Assembly and stabilization of photosystem complexes, potentially through direct or indirect interactions with structural components.

Researchers should evaluate these functions through comparative proteoliposome experiments, with and without functional cemA, measuring parameters such as H⁺/CO₂ exchange rates, membrane potential stability, and electron transport efficiency. These experiments are particularly valuable when comparing cemA variants from different Brassicaceae species that have adapted to diverse environmental conditions.

What experimental controls are essential when characterizing recombinant Draba nemorosa cemA function?

Robust experimental design for cemA functional characterization requires several critical controls:

  • Protein-level controls:

    • Inactive cemA mutants (site-directed mutagenesis of conserved residues)

    • Related membrane proteins with different functions (negative control)

    • Native isolated cemA from chloroplast preparations (positive control)

  • System-level controls:

    • Empty vector/expression system preparations

    • Heterologous expression of cemA orthologs from related species (e.g., Arabis stellari)

    • Temperature and pH gradient controls to distinguish passive from protein-mediated processes

  • Validation controls:

    • Antibody specificity verification using western blots against both recombinant and native cemA

    • Mass spectrometry confirmation of purified protein identity

    • Functional complementation in cemA-deficient systems

These controls help distinguish cemA-specific effects from background processes and validate that the recombinant protein maintains native-like function.

How can researchers optimize codon usage for heterologous expression of Draba nemorosa cemA?

Optimizing codon usage for heterologous expression of Draba nemorosa cemA requires:

  • Comprehensive analysis of the chloroplast codon bias in Draba nemorosa, which typically has a GC content of approximately 36.4% . This differs significantly from many expression hosts.

  • Implementation of a codon adaptation index (CAI) analysis to identify rare codons in the expression host that correspond to common codons in D. nemorosa chloroplast genome.

  • Systematic replacement of rare codons while preserving regulatory elements and avoiding the introduction of unwanted secondary structures in the mRNA.

  • Consideration of expression host-specific optimization:

    • For E. coli: Avoid AGG, AGA, CGA (arginine), CUA (leucine), and AUA (isoleucine)

    • For yeast systems: Adapt based on species-specific preferences

    • For plant expression: Consider nuclear codon bias rather than chloroplast bias

  • Validation of optimized constructs through comparative expression trials with the native sequence.

This optimization can significantly increase expression yields, often by 5-10 fold, particularly for membrane proteins like cemA that may otherwise express poorly.

What spectroscopic methods are most informative for structural characterization of recombinant cemA protein?

For structural characterization of recombinant cemA, researchers should employ complementary spectroscopic approaches:

How should researchers interpret conflicting phylogenetic signals when analyzing cemA across Draba species?

When faced with conflicting phylogenetic signals in cemA analysis across Draba species:

  • Implement partitioned analyses that account for different evolutionary rates within the gene, as membrane-spanning regions often evolve at different rates than soluble domains.

  • Compare phylogenies constructed from cemA with those from other chloroplast genes (such as matK, ycf1, and rbcL) which have been shown to have varying selection pressures in Brassicaceae .

  • Utilize appropriate evolutionary models that account for heterogeneity across sites (e.g., mixed-effects models of evolution) rather than applying a single model to the entire sequence.

  • Consider horizontal gene transfer scenarios, especially when cemA phylogeny conflicts with established relationships based on multiple genes.

  • Evaluate the impact of incomplete lineage sorting through coalescent-based methods, particularly important in recently diverged Draba species.

These approaches help distinguish true biological signals from methodological artifacts and can resolve apparent conflicts in evolutionary history reconstruction.

What are the key considerations when comparing cemA function between recombinant systems and native chloroplast environments?

When comparing cemA function between recombinant systems and native environments, researchers must consider:

  • Lipid environment differences:

    • Native chloroplast membranes contain unique galactolipids (MGDG, DGDG) critical for protein function

    • Recombinant systems often use standard phospholipids that may alter protein conformation

  • Protein interaction partners:

    • In chloroplasts, cemA operates within a complex network of proteins

    • Isolated recombinant systems lack these interaction partners

  • Redox environment:

    • Chloroplasts maintain specific redox potentials during photosynthesis

    • Recombinant systems require careful redox control to mimic these conditions

  • Post-translational modifications:

    • Native cemA may undergo specific modifications absent in recombinant systems

    • These differences can significantly impact function and localization

  • pH and ion gradients:

    • Chloroplast thylakoid membranes maintain strong proton gradients

    • Reconstitution experiments must establish similar electrochemical conditions

These factors should be systematically addressed through complementary approaches, including both in vitro reconstitution and in vivo studies in model plant systems, to develop a complete understanding of cemA function.

What are the most promising approaches for studying cemA protein-protein interactions in Draba nemorosa?

For investigating cemA protein-protein interactions in Draba nemorosa, the most promising approaches include:

  • Proximity-based labeling techniques:

    • BioID or TurboID fusions with cemA expressed in chloroplasts

    • APEX2-based proximity labeling for temporal resolution of interactions

    • These methods identify neighboring proteins in the native membrane environment

  • Co-immunoprecipitation with crosslinking:

    • Chemical crosslinkers optimized for membrane protein complexes

    • GFP-trap pulldowns with cemA-GFP fusions expressed in plant systems

    • Mild solubilization conditions to preserve native interactions

  • Split-reporter systems:

    • Split-GFP or split-luciferase complementation assays

    • Bimolecular fluorescence complementation (BiFC) for visualization in chloroplasts

    • These approaches confirm direct interactions and provide spatial information

  • Computational prediction and validation:

    • Homology-based interaction predictions from related species

    • Coevolution analysis to identify potential interaction partners

    • Molecular docking simulations followed by experimental validation

  • Cryo-electron tomography:

    • Direct visualization of cemA within the membrane environment

    • Identification of associated protein complexes in near-native state

These complementary approaches can reveal the interaction network of cemA, providing insights into its functional roles beyond what can be determined from sequence analysis alone.

How might CRISPR-Cas9 genome editing be applied to study cemA function in Draba nemorosa?

CRISPR-Cas9 approaches for studying cemA function in Draba nemorosa must address the unique challenges of chloroplast genome editing:

  • Chloroplast-targeted CRISPR systems:

    • Design specialized delivery methods for chloroplast transformation

    • Utilize chloroplast-compatible promoters for guide RNA and Cas9 expression

    • Consider chloroplast-specific codon optimization for Cas9

  • Precise editing strategies:

    • Site-directed mutagenesis of conserved motifs identified through comparative analysis with Arabis and other Brassicaceae

    • Creation of chimeric proteins with domains from different species

    • Introduction of epitope or affinity tags for tracking and purification

  • Selection and screening approaches:

    • Develop spectinomycin or other antibiotic resistance markers for chloroplast transformation

    • Design phenotypic screens based on photosynthetic efficiency

    • Implement PCR-based screening methods for homoplasmy verification

  • Functional validation:

    • Complementation assays with wild-type cemA

    • Comparative growth analysis under various CO₂ conditions

    • Integration with proteomics to assess impacts on the chloroplast protein network

  • Technical considerations:

    • Address homoplasmy challenges through multiple rounds of selection

    • Develop tissue culture protocols specific for Draba nemorosa

    • Consider biolistic delivery methods optimized for chloroplast transformation

This approach would overcome current limitations in understanding cemA function by enabling direct manipulation in the native genomic context.

What are common pitfalls in recombinant cemA expression and how can they be overcome?

Researchers frequently encounter several challenges when expressing recombinant cemA:

ChallengeSymptomsSolution Strategies
Protein MisfoldingInclusion body formation, aggregationLower induction temperature (16-20°C); use specialized strains (C41/C43); co-express chaperones
Toxic Effects on HostPoor growth, plasmid instabilityUse tightly regulated promoters; lower expression levels; test different host strains
Low YieldMinimal detectable proteinOptimize codon usage; add stabilizing fusion partners; increase membrane capacity of expression host
Proteolytic DegradationMultiple bands or smears on Western blotAdd protease inhibitors; remove recognition sites through silent mutations; reduce expression time
Improper Membrane InsertionNon-functional protein despite expressionInclude native signal sequences; use in vitro translation systems with microsomes; consider membrane-mimetic environments

Additionally, using fusion partners that enhance membrane protein folding (such as GFP or MBP) can significantly improve expression success. For particularly challenging constructs, cell-free expression systems with supplied lipid nanodiscs have shown promise for producing functional membrane proteins like cemA.

How can researchers address inconsistent results when measuring cemA activity across different experimental systems?

To address inconsistent cemA activity results across experimental systems:

  • Standardize protein quantification methods:

    • Use absolute quantification approaches rather than relative measurements

    • Employ multiple methods (e.g., Western blot and fluorescence) to confirm protein levels

  • Normalize activity measurements:

    • Express activity per unit of confirmed active protein

    • Use internal standards across experimental batches

  • Control environmental variables:

    • Maintain consistent temperature, pH, and ionic conditions

    • Document and report all buffer components in detail

  • Implement quality control checkpoints:

    • Verify protein integrity before each experiment

    • Confirm membrane incorporation using specific assays

  • Develop robust activity assays:

    • Design multiple complementary activity measurements

    • Include appropriate positive and negative controls in each experiment

    • Establish clear criteria for data inclusion/exclusion

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.