Recombinant Draba nemorosa NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

What is NAD(P)H-Quinone Oxidoreductase and what is its primary function in Draba nemorosa?

NAD(P)H-Quinone Oxidoreductase (NQO) is an enzyme that catalyzes the two-electron reduction of quinones and a wide range of other organic compounds. In Draba nemorosa (Woodland whitlowgrass), the chloroplastic form plays a critical role in the plant's electron transport chain. Its physiological functions include reducing the free radical load in cells and detoxification of xenobiotics . The subunit 3 (encoded by the ndhC gene) is specifically integrated into the chloroplastic NDH complex, which is involved in cyclic electron flow around photosystem I and chlororespiration .

How does the structure of Draba nemorosa NAD(P)H-Quinone Oxidoreductase Subunit 3 compare to other plant species?

The Draba nemorosa NAD(P)H-Quinone Oxidoreductase Subunit 3 consists of 120 amino acids with a sequence of "MFLLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFLEAFIFVLILILGLVYAWRKGALEWS" . This protein shows high conservation of functional domains when compared to other plant species, particularly in regions associated with quinone binding and electron transfer. While specific crystal structures for the Draba nemorosa enzyme aren't available in the search results, NAD(P)H quinone oxidoreductases generally function as homodimers with two active sites formed from residues contributed by both polypeptide chains .

What is the relationship between NAD(P)H-Quinone Oxidoreductases and Azoreductases?

Recent research indicates that NAD(P)H-Quinone Oxidoreductases and Azoreductases belong to the same FMN-dependent superfamily of enzymes. Studies using azoreductases from Pseudomonas aeruginosa have demonstrated that these enzymes can rapidly reduce quinones, suggesting overlapping functionality. Both enzyme types utilize related reaction mechanisms, further supporting their classification in a single enzyme superfamily . This evolutionary relationship explains their broad substrate specificity profiles and suggests they play diverse roles in cellular survival under adverse conditions .

What are the optimal conditions for reconstitution and storage of recombinant Draba nemorosa NAD(P)H-Quinone Oxidoreductase Subunit 3?

For optimal reconstitution of the lyophilized recombinant protein:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended)

• Aliquot for long-term storage

For storage:

• Store at -20°C/-80°C upon receipt

• Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

• Repeated freezing and thawing is not recommended as it may compromise protein activity

How can researchers verify the purity and activity of recombinant Draba nemorosa NAD(P)H-Quinone Oxidoreductase Subunit 3?

Purity verification:

• SDS-PAGE analysis is the standard method for assessing purity, with properly prepared recombinant protein showing >90% purity

• Western blotting using antibodies against the His-tag can confirm identity

• Mass spectrometry can provide additional verification of the intact protein mass

Activity assays:

• Standard enzymatic activity can be measured spectrophotometrically by monitoring the oxidation of NAD(P)H at 340 nm in the presence of appropriate quinone substrates

• Control experiments should include heat-inactivated enzyme samples

• Negative cooperativity, which has been observed in quinone oxidoreductases, should be considered when interpreting kinetic data

• Comparative activity assessment with other recombinant subunits (such as subunit 6 or 4L) can provide context for functional analysis

What approaches can be used to investigate protein-protein interactions of NAD(P)H-Quinone Oxidoreductase Subunit 3 in the chloroplastic NDH complex?

Several complementary approaches can be employed:

• Co-immunoprecipitation (Co-IP):

  • Using antibodies against the His-tag of the recombinant protein to pull down interaction partners

  • Followed by mass spectrometry identification of co-precipitated proteins

• Yeast two-hybrid (Y2H) screening:

  • Using the ndhC gene as bait to identify potential interacting partners

  • Verification of interactions through reciprocal Y2H experiments

• Bimolecular Fluorescence Complementation (BiFC):

  • For in vivo visualization of protein-protein interactions in plant cells

  • Particularly useful for confirming interactions within the chloroplast

• Blue Native PAGE:

  • For analyzing intact protein complexes

  • Can reveal the integration of subunit 3 into the larger NDH complex

• Cross-linking mass spectrometry:

  • To identify proximal amino acid residues between interacting proteins

  • Provides structural insights into complex formation

When interpreting results, researchers should consider that NAD(P)H quinone oxidoreductases function as dimers with active sites formed from residues from both polypeptide chains .

How does the FAD cofactor binding affect the catalytic activity of NAD(P)H-Quinone Oxidoreductase?

The FAD cofactor is essential for the catalytic function of NAD(P)H-Quinone Oxidoreductase. The enzyme utilizes a substituted enzyme mechanism involving a tightly bound FAD cofactor for the two-electron reduction of quinones . The strength of FAD binding directly influences enzyme stability and activity - weaker binding correlates with reduced activity.

Research on human NQO1 has demonstrated that the affinity for FAD is critical; the cancer-associated polymorphic variant p.P187S has substantially reduced affinity for FAD, resulting in lower stability and activity . While this specific mutation has been studied in human enzymes, the principle applies to plant NQOs as well.

For experimental investigation of FAD's role in Draba nemorosa NQO subunit 3:

• UV-visible spectroscopy can monitor FAD binding (characteristic absorption at 450 nm)

• Fluorescence quenching experiments can quantify FAD-protein interactions

• Site-directed mutagenesis of predicted FAD-binding residues can elucidate critical amino acids

• Thermal shift assays can assess the stabilizing effect of FAD on protein structure

What are the primary challenges in expressing and purifying functional recombinant NAD(P)H-Quinone Oxidoreductase subunits?

Researchers face several technical challenges when working with recombinant NAD(P)H-Quinone Oxidoreductase subunits:

• Maintaining proper protein folding:

  • As membrane-associated proteins, NQO subunits often contain hydrophobic regions that can lead to aggregation during expression

  • The amino acid sequence of subunit 3 (MFLLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFLEAFIFVLILILGLVYAWRKGALEWS) contains multiple hydrophobic stretches

• Cofactor incorporation:

  • Ensuring proper FAD incorporation during recombinant expression

  • Supplementation of growth media with riboflavin may improve FAD availability

• Maintaining stability:

  • Proper storage conditions are critical (avoiding freeze-thaw cycles)

  • Addition of glycerol (5-50%) helps maintain stability during storage

• Reconstitution of multi-subunit complexes:

  • Individual subunits may not recapitulate the full activity of the native complex

  • Co-expression strategies may be necessary for functional studies

• Assay development:

  • Designing appropriate assays that reflect physiological conditions

  • Accounting for negative cooperativity in kinetic analyses

How can researchers differentiate between the activities of different NAD(P)H-Quinone Oxidoreductase subunits?

Differentiating between the activities of various NAD(P)H-Quinone Oxidoreductase subunits requires a multi-faceted approach:

• Substrate specificity profiling:

  • Test each subunit against a panel of quinone substrates

  • Measure reaction rates using spectrophotometric assays monitoring NAD(P)H oxidation

  • Create kinetic profiles (Km, Vmax, kcat) for each substrate-subunit combination

• Inhibitor sensitivity analysis:

  • Determine IC50 values for known inhibitors like dicoumarol

  • Develop subunit-specific inhibition fingerprints

• pH and temperature optima determination:

  • Measure activity across pH ranges (typically 5.5-8.5)

  • Determine thermal stability profiles using differential scanning fluorimetry

• Electron donor preference:

  • Compare relative activities with NADH versus NADPH

  • Calculate NADH/NADPH utilization ratios for each subunit

• Comparative analysis table:

Note: Some values are not available from the search results and would need to be experimentally determined.

How does protein mobility affect the function and negative cooperativity observed in NAD(P)H-Quinone Oxidoreductases?

NAD(P)H-Quinone Oxidoreductases demonstrate negative cooperativity, which is believed to be mediated at least in part by alterations to protein mobility . This means that binding of substrate to one subunit affects the binding affinity at the second subunit of the dimer.

This phenomenon can be investigated through:

• Molecular dynamics simulations:

  • Modeling conformational changes upon substrate binding

  • Identifying allosteric communication pathways between subunits

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Mapping regions of altered flexibility upon substrate binding

  • Identifying dynamic regions involved in cooperativity

• NMR spectroscopy:

  • Measuring chemical shift perturbations upon substrate binding

  • Characterizing μs-ms timescale motions related to allostery

• Site-directed mutagenesis:

  • Targeting residues at subunit interfaces

  • Modifying residues in predicted allosteric pathways

  • Measuring effects on cooperativity through enzyme kinetics

The human NQO1 p.P187S variant provides insight into how protein mobility affects function - inappropriate mobility results in lower stability, reduced FAD binding, and ultimately dysfunction . Similar principles likely apply to plant NAD(P)H-Quinone Oxidoreductases, where proper dynamic behavior would be essential for catalytic function.

What are the evolutionary relationships between chloroplastic NAD(P)H-Quinone Oxidoreductase subunits across different plant species?

Understanding the evolutionary relationships between chloroplastic NAD(P)H-Quinone Oxidoreductase subunits requires comprehensive phylogenetic analysis:

• Sequence alignment strategies:

  • Multiple sequence alignment of ndhC (subunit 3) genes from diverse plant species

  • Identification of conserved catalytic residues versus rapidly evolving regions

  • Analysis of selection pressure using dN/dS ratios

• Structural comparison approaches:

  • Homology modeling based on available crystal structures

  • Superposition of predicted structures to identify conserved folding patterns

  • Analysis of subunit interfaces across species

• Functional divergence assessment:

  • Comparative enzymology of recombinant subunits from different species

  • Substrate specificity profiling to identify species-specific adaptations

  • Cross-species complementation studies

• Integration with plant phylogeny:

  • Correlation of NQO evolution with major plant evolutionary transitions

  • Assessment of chloroplast genome evolution and gene transfer events

  • Comparison with mitochondrial homologs to understand organellar co-evolution

The relationship between NAD(P)H-Quinone Oxidoreductases and Azoreductases as members of the same FMN-dependent superfamily provides an additional evolutionary perspective , suggesting ancient and conserved functional roles for these enzymes.

How do post-translational modifications regulate the activity and stability of NAD(P)H-Quinone Oxidoreductase in plant systems?

Post-translational modifications (PTMs) likely play significant roles in regulating NAD(P)H-Quinone Oxidoreductase activity, although specific information for Draba nemorosa is not detailed in the search results. Researchers can investigate these regulatory mechanisms through:

• PTM identification methodologies:

  • Mass spectrometry-based proteomics to identify phosphorylation, acetylation, etc.

  • Enrichment strategies for specific modifications (TiO2 for phosphopeptides)

  • Western blotting with PTM-specific antibodies

• Functional consequences assessment:

  • Site-directed mutagenesis of modified residues (phosphomimetic mutations)

  • In vitro enzymatic assays comparing modified and unmodified forms

  • Protein stability measurements using thermal shift assays

• Regulatory pathway mapping:

  • Identification of kinases/phosphatases that target NQO subunits

  • Stress response experiments to determine conditions triggering PTMs

  • Correlation with physiological changes in plants

• Structural impacts analysis:

  • Molecular dynamics simulations incorporating PTMs

  • HDX-MS to detect changes in protein dynamics upon modification

  • Crystallographic studies of modified proteins when possible

• Potential regulatory PTMs to investigate:

  • Phosphorylation (particularly at Ser/Thr residues)

  • Redox-based modifications (disulfide formation, glutathionylation)

  • Acetylation of lysine residues

  • Ubiquitination and its impact on protein turnover

How can recombinant NAD(P)H-Quinone Oxidoreductase subunits be used to study chloroplast function in stress conditions?

Recombinant NAD(P)H-Quinone Oxidoreductase subunits provide valuable tools for investigating chloroplast responses to various stress conditions:

• Oxidative stress studies:

  • In vitro assays measuring quinone reduction rates under varying H2O2 concentrations

  • Correlation with in vivo measurements of reactive oxygen species in chloroplasts

  • Comparison between wild-type and stress-tolerant plant varieties

• Temperature stress investigation:

  • Thermal stability profiling of recombinant subunits

  • Activity assays at temperature extremes

  • Correlation with chloroplast function during heat/cold stress

• Drought stress responses:

  • Analysis of post-translational modifications under dehydration conditions

  • Activity measurements in the presence of osmolytes

  • Integration with broader photosynthetic acclimation mechanisms

• Methodological approaches:

  • Reconstitution of recombinant subunits into liposomes for transport studies

  • Development of biosensors using recombinant proteins

  • Complementation studies in mutant plants

• Comparative analysis across species:

  • Using recombinant proteins from stress-tolerant vs. sensitive species

  • Structure-function correlations related to stress adaptation

  • Identification of critical residues for engineering stress tolerance

What considerations are important when designing inhibitor studies for NAD(P)H-Quinone Oxidoreductase in plant systems?

When designing inhibitor studies for NAD(P)H-Quinone Oxidoreductase in plant systems, researchers should consider:

• Inhibitor selection criteria:

  • Known inhibitors like dicoumarol and structurally related compounds

  • Natural product inhibitors from plant defense compounds

  • Rational design based on enzyme structure

• Experimental design considerations:

  • Pre-incubation protocols to account for slow-binding inhibitors

  • Proper controls for solvent effects (many inhibitors require DMSO)

  • Enzyme concentration effects on apparent inhibition constants

• Mode of inhibition characterization:

  • Kinetic analysis to distinguish competitive, uncompetitive, and non-competitive mechanisms

  • Analysis of inhibitor effects on different substrates (NAD(P)H vs. quinones)

  • Thermal shift assays to detect inhibitor binding

• Selectivity profiling:

  • Testing against multiple NQO subunits (3, 4L, 6) to assess specificity

  • Evaluation against related enzymes to determine cross-reactivity

  • Development of selectivity indices for comparative analysis

• In vivo correlation studies:

  • Methods to deliver inhibitors to chloroplasts

  • Phenotypic assays to measure physiological impacts

  • Integration with photosynthetic measurements

• Data analysis approaches:

  • Global fitting of inhibition data to appropriate models

  • Accounting for negative cooperativity in inhibition mechanisms

  • Statistical analysis for detecting subtle inhibition effects

What are the most promising future research directions for understanding NAD(P)H-Quinone Oxidoreductase function in plant systems?

Several promising research directions emerge from current understanding:

• Structural biology approaches:

  • High-resolution structural determination of plant-specific NQO subunits

  • Cryo-EM analysis of intact NDH complexes

  • Computational modeling of electron transport pathways

• Systems biology integration:

  • Metabolic flux analysis to quantify electron flow through NDH complexes

  • Integration with broader photosynthetic regulatory networks

  • Multi-omics approaches connecting genotype to phenotype

• Climate adaptation studies:

  • Comparative analysis of NDH complexes from plants adapted to extreme environments

  • Investigation of NDH function in C3 vs. C4 photosynthesis

  • Engineering of modified NDH complexes for enhanced stress tolerance

• Methodological advances:

  • Development of in vivo sensors for NDH activity

  • Single-molecule techniques to study dynamic behavior

  • Optogenetic approaches to control NDH function

• Translational applications:

  • Crop improvement strategies targeting NDH function

  • Bioengineering approaches for enhanced photosynthetic efficiency

  • Development of plant-based biosensors for environmental monitoring

How can contradictions in experimental data regarding NAD(P)H-Quinone Oxidoreductase function be reconciled?

When faced with contradictory experimental data on NAD(P)H-Quinone Oxidoreductase function, researchers should apply these methodological approaches:

• Experimental condition standardization:

  • Detailed documentation of buffer compositions, pH, and temperatures

  • Standardized protein preparation protocols

  • Consistent enzyme activity assay conditions

• Technical variations assessment:

  • Comparison of different expression systems (E. coli vs. plant-based)

  • Evaluation of tag effects (N-terminal vs. C-terminal His tags)

  • Analysis of protein purity impact on activity measurements

• Reconciliation strategies:

  • Collaborative cross-laboratory validation studies

  • Meta-analysis of published data with statistical approaches

  • Development of standard reference materials

• Biological complexity considerations:

  • Recognition of tissue-specific and developmental differences

  • Assessment of post-translational modification effects

  • Evaluation of complex assembly status

• Methodological triangulation:

  • Application of multiple complementary techniques

  • In vitro to in vivo correlation studies

  • Integration of structural, biochemical, and genetic approaches

The relationship between NAD(P)H-Quinone Oxidoreductases and Azoreductases demonstrates how apparent contradictions can lead to new insights - these were previously considered separate enzyme classes but are now recognized as belonging to the same enzyme superfamily .

What parallels exist between plant NAD(P)H-Quinone Oxidoreductases and their bacterial or mammalian counterparts?

Understanding the parallels between plant, bacterial, and mammalian NAD(P)H-Quinone Oxidoreductases provides valuable evolutionary and functional insights:

• Mechanistic conservation:

  • All use a substituted enzyme mechanism involving tightly bound FAD cofactors

  • Two-electron reduction mechanism is preserved across kingdoms

  • Similar catalytic residues despite sequence divergence

• Structural similarities:

  • Homodimeric functional units with active sites formed from both chains

  • Conserved FAD binding domains

  • Related protein dynamics and cooperativity mechanisms

• Functional divergence:

  • Mammalian NQO1 has additional roles in stabilizing cellular regulators like p53

  • Plant forms participate in chloroplast-specific electron transport

  • Bacterial forms may have broader substrate specificity profiles

• Evolutionary relationships:

  • Inclusion in the same FMN-dependent superfamily along with azoreductases

  • Shared ancestry with evidence of specialization

  • Convergent evolution of regulatory mechanisms

• Applied research implications:

  • Bacterial systems as simplified models for understanding fundamental mechanisms

  • Translational potential of findings across kingdoms

  • Comparative approaches to identify unique regulatory features