Recombinant Draba nemorosa Photosystem Q (B) protein
Shipped with Ice Packs 
In Stock 
Description
Introduction and Definition
Recombinant Draba nemorosa Photosystem Q(B) protein refers to a bioengineered version of the Photosystem II (PSII) Q(B) protein (also known as D1 protein) produced through heterologous expression in Escherichia coli. This protein is a critical component of the PSII reaction center complex in plants like Draba nemorosa (woodland whitlowgrass), where it facilitates electron transfer during oxygenic photosynthesis .
Recombinant Production
The recombinant Q(B) protein is synthesized in E. coli with an N-terminal His tag for affinity purification. Key technical details include:
| Parameter | Value |
|---|---|
| Form | Lyophilized powder |
| Storage Buffer | Tris-based buffer + 50% glycerol (pH 8.0) |
| Purity | >90% (SDS-PAGE) |
| Reconstitution | Sterile deionized water (0.1–1.0 mg/mL) + 5–50% glycerol (for long-term storage) |
| Stability | Stable at -20°C/-80°C; avoid repeated freeze-thaw cycles |
Role in PSII Function
-
Electron Transport: The Q(B) protein binds quinones (e.g., plastoquinone) and facilitates electron transfer from P680 to the acceptor side of PSII .
-
Herbicide Target: PSII herbicides (e.g., atrazine) bind to the Q(B) pocket, inhibiting electron flow .
-
Turnover and Assembly: In Arabidopsis, rubredoxin 1 (RBD1) regulates ribosome recruitment of psbA mRNA, affecting D1 synthesis and PSII assembly .
Experimental Uses
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Draba nemorosa (Woodland whitlowgrass)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL
LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF
NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.
Target Background
Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP formation. PSII consists of a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
