Recombinant Dromaius novaehollandiae Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us for preferential development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Dromaius novaehollandiae (Emu)
Target Names
Target Protein Sequence
AICSLVLYLLTLMLMEKLSSNTVDAQEVELIWTILPAIVLILLALPSLQILYMMDEIDEP DLTLKAIGHQWYWTYEYTDFKDLSFDSYMVPTSELPSGHFRLLEVDHRVVVPMESPIRVI ITAGDVLHSWAVPTLGVKTDAIPGRLNQTSFITTRPGIFYGQCSEICGANHSYMPIVVES TPLTHFENWSSLLSASSSL
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme is crucial for oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, composed of heme a3 and copper B (CuB), reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 (MT-CO2) and what is its role in cellular metabolism?

Cytochrome c Oxidase Subunit 2 (MT-CO2, also known as COX2, COII, or COXII) is one of the core subunits of mitochondrial Cytochrome c Oxidase (Complex IV), which serves as the terminal enzyme in the respiratory electron transport chain. This transmembrane protein complex receives electrons from cytochrome c molecules and transfers them to molecular oxygen while simultaneously pumping protons across the inner mitochondrial membrane . MT-CO2 specifically contains the primary binding site for cytochrome c and houses the binuclear copper center (CuA) that acts as the initial electron acceptor in the complex . This subunit plays a critical role in the electron transfer process that ultimately contributes to ATP production through oxidative phosphorylation . In Dromaius novaehollandiae (Emu), as in other species, MT-CO2 is encoded by the mitochondrial genome and is integral to cellular energy production, particularly in tissues with high metabolic demands .

What expression systems are recommended for producing recombinant Dromaius novaehollandiae MT-CO2?

For optimal expression of recombinant Dromaius novaehollandiae MT-CO2, Escherichia coli-based prokaryotic expression systems have been demonstrated to be effective for MT-CO2 proteins from various species . Based on successful protocols for other species, the full-length coding sequence (typically around 227 amino acids) should be cloned into an appropriate expression vector such as pET-32a with an N-terminal His-tag for purification purposes. The recombinant protein can be induced using isopropyl β-d-thiogalactopyranoside (IPTG) in E. coli strains optimized for membrane protein expression, such as E. coli Transetta (DE3) . For avian MT-CO2 specifically, careful optimization of expression conditions is necessary, including temperature modulation (typically 18-25°C post-induction) to prevent inclusion body formation and enhance proper folding. The expression strategy should account for the hydrophobic nature of this membrane protein, potentially requiring specialized detergents or solubilization agents during purification .

What are the critical functional domains in MT-CO2 and how can they be identified in the Dromaius novaehollandiae sequence?

The MT-CO2 protein contains several crucial functional domains that can be identified in the Dromaius novaehollandiae sequence through bioinformatic analysis and alignment with well-characterized homologs. The most critical functional element is the CuA binding site, which involves two conserved Cys and two His residues along with a potential alternative Met residue . This binuclear copper center serves as the primary electron acceptor from cytochrome c. Additionally, four invariant acidic amino acid residues (two Asp and two Glu) involved in interactions with cytochrome c should be identifiable through sequence alignment . The characteristic region of aromatic residues (Tyr-Gln-Trp-Tyr-Trp-Gly-Tyr-Glu-Tyr) involved in electron transfer is another key feature to identify . Hydropathy profile analysis can help identify transmembrane helices, with avian MT-CO2 likely containing two definitive transmembrane helices similar to bovine COXII, plus a potential third helix that may function as part of a signal sequence . For experimental verification of these domains, site-directed mutagenesis of conserved residues followed by functional assays measuring electron transfer efficiency would be recommended to confirm the importance of predicted functional sites.

How does the three-dimensional structure of MT-CO2 contribute to its function in the cytochrome c oxidase complex?

The three-dimensional structure of MT-CO2 is fundamental to its role in electron transfer within the cytochrome c oxidase complex. MT-CO2 adopts a conformation where the CuA center is positioned proximal to the intermembrane space, ideally situated to accept electrons from cytochrome c . The protein has a globular domain containing the CuA center anchored to the inner mitochondrial membrane by transmembrane helices . This arrangement facilitates the initial electron acceptance from cytochrome c at the CuA center and subsequent transfer to cytochrome a in subunit I, followed by transfer to the binuclear center (heme a3/CuB) where oxygen reduction occurs . The specific folding pattern creates an electrostatically favorable binding surface for cytochrome c, with conserved acidic residues forming ionic interactions with the positively charged surface of cytochrome c . The conserved aromatic residue region likely creates an electron transfer pathway between the cytochrome c binding site and the CuA center . Recent evolutionary studies have shown that in anthropoid primates, 27 of the 57 residues involved in binding cytochrome c have been replaced, with 11 charge-bearing residues being replaced with uncharged residues, suggesting species-specific adaptations in this interaction interface .

What is the significance of studying MT-CO2 from diverse species like Dromaius novaehollandiae in the context of mitochondrial evolution?

Studying MT-CO2 from diverse species like Dromaius novaehollandiae offers crucial insights into mitochondrial evolution and the co-evolution of nuclear and mitochondrial genomes. As one of the core subunits encoded by the mitochondrial genome, MT-CO2 provides a unique window into the evolutionary history of the endosymbiotic event that led to the formation of eukaryotic cells . The integration of nuclear-encoded subunits to regulate the activity of mitochondrial-encoded core subunits represents a fundamental aspect of eukaryotic evolution, described as a "domestication scenario" where the host increasingly controls the ancestral activity of cytochrome c oxidase . Studying MT-CO2 across diverse lineages helps elucidate how different ecological and physiological demands have shaped mitochondrial function. For example, the unique physiological characteristics of the Monito del Monte (Dromiciops gliroides), the sole living representative of an otherwise extinct marsupial order, show some "reptilian" physiological characteristics and relatively low repeatability of physiological variables . Similar studies with Dromaius novaehollandiae MT-CO2 could reveal adaptations specific to the ratite lineage and contribute to our understanding of avian evolution. Additionally, comparative analyses across species with varying metabolic rates, body sizes, and ecological niches can illuminate how natural selection has optimized mitochondrial function in different evolutionary contexts.

What purification strategies are most effective for obtaining high-quality recombinant Dromaius novaehollandiae MT-CO2?

For obtaining high-quality recombinant Dromaius novaehollandiae MT-CO2, a multi-step purification strategy is recommended based on protocols used for similar proteins. Initially, affinity chromatography using Ni(2+)-NTA agarose is effective for His-tagged recombinant MT-CO2 proteins, as demonstrated with Sitophilus zeamais MT-CO2 . Following bacterial expression in E. coli and cell lysis (preferably using mild detergents to preserve protein structure), the clarified lysate should be loaded onto a pre-equilibrated Ni(2+)-NTA column and washed extensively to remove non-specifically bound proteins. Elution with an imidazole gradient typically yields protein of approximately 90-95% purity . For higher purity, additional chromatographic steps are recommended, such as ion-exchange chromatography followed by size-exclusion chromatography to remove aggregates and obtain homogeneous protein. Given the membrane-associated nature of MT-CO2, the inclusion of appropriate detergents throughout the purification process is crucial; commonly used detergents include n-dodecyl β-D-maltoside (DDM) or digitonin at concentrations above their critical micelle concentration. The final purified protein should be confirmed by SDS-PAGE, with expected molecular mass around 26-27 kDa for the native protein, or 44 kDa with fusion tags as observed with Sitophilus zeamais MT-CO2 . Western blotting using anti-His antibodies or specific anti-MT-CO2 antibodies can further confirm identity and purity.

What are the optimal storage conditions for maintaining the stability and activity of recombinant Dromaius novaehollandiae MT-CO2?

To maintain stability and activity of recombinant Dromaius novaehollandiae MT-CO2, proper storage conditions are essential, as this membrane protein is prone to aggregation and denaturation. Based on protocols for similar recombinant MT-CO2 proteins, the purified protein is best stored as a lyophilized powder to enhance long-term stability . For short-term storage (up to one month), the protein can be kept at 2-8°C in an appropriate buffer system such as Tris/PBS-based buffer (pH 8.0) containing 5-6% trehalose as a stabilizing agent . For longer-term storage, aliquoting and storing at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity . When reconstituting the lyophilized protein, it should be briefly centrifuged to bring contents to the bottom, then dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of 5-50% glycerol (final concentration) is recommended for samples intended for freezing, with 50% being optimal for long-term storage at -20°C/-80°C . The stability can be monitored through accelerated thermal degradation tests, where incubation at 37°C for 48h should result in less than 5% loss of activity under appropriate storage conditions . Avoiding vortexing during reconstitution is crucial to prevent protein denaturation .

What assays can be used to validate the functional integrity of purified recombinant Dromaius novaehollandiae MT-CO2?

Several complementary assays can be employed to validate the functional integrity of purified recombinant Dromaius novaehollandiae MT-CO2. The primary functional assay is measuring the protein's ability to catalyze the oxidation of reduced cytochrome c, which can be monitored spectrophotometrically by tracking absorbance changes at 550 nm . A properly folded and functional MT-CO2 should demonstrate concentration-dependent catalytic activity in this assay. Circular dichroism (CD) spectroscopy can be used to assess the secondary structure content, comparing it with known structures of MT-CO2 from other species to confirm proper folding. Thermal shift assays using differential scanning fluorimetry can determine the thermal stability (melting temperature) of the protein, providing information about its structural integrity. For more detailed functional characterization, oxygen consumption measurements using an oxygen electrode (Clark-type) in the presence of reduced cytochrome c can directly assess the protein's ability to reduce oxygen. Advanced biophysical techniques such as EPR spectroscopy can verify the proper formation of the CuA center by detecting its characteristic spectral signature. Inhibition studies using known cytochrome c oxidase inhibitors like cyanide or carbon monoxide can further validate functional integrity by demonstrating expected inhibition patterns. Finally, molecular docking studies with substrates or inhibitors, such as the analysis performed with allyl isothiocyanate (AITC) on Sitophilus zeamais MT-CO2, can provide insights into binding site functionality .

How can recombinant Dromaius novaehollandiae MT-CO2 be used to study mitochondrial dysfunction in avian models?

Recombinant Dromaius novaehollandiae MT-CO2 offers a valuable tool for investigating mitochondrial dysfunction in avian models through several sophisticated approaches. By developing antibodies against the recombinant protein, researchers can quantify MT-CO2 expression levels in various tissues from healthy and diseased avian samples, providing insights into pathological alterations in mitochondrial function. The purified protein can serve as a platform for screening compounds that modulate cytochrome c oxidase activity, potentially identifying therapeutic agents for mitochondrial disorders. Structure-function studies comparing wild-type MT-CO2 with mutant variants can elucidate the molecular mechanisms underlying mitochondrial dysfunction. The recombinant protein can be incorporated into liposomes or nanodiscs to create minimal functional units for studying electron transport chain dynamics under controlled conditions, allowing manipulation of lipid composition and redox environment to mirror pathological states. Additionally, comparative studies between Dromaius novaehollandiae MT-CO2 and MT-CO2 from other avian species with different metabolic rates could reveal insights into adaptations for energy efficiency. Such studies are particularly relevant given that birds like the Monito del Monte (Dromiciops gliroides) exhibit unusual physiological characteristics, including poor control of body temperature with thermal amplitude of approximately 10°C in normothermia and relatively low repeatability of metabolic rate measurements .

What insights can be gained from studying the interaction between recombinant Dromaius novaehollandiae MT-CO2 and environmental factors such as hypoxia or temperature variation?

Studying the interaction between recombinant Dromaius novaehollandiae MT-CO2 and environmental factors provides critical insights into avian adaptations to ecological challenges. Emus, native to Australia, experience significant temperature variations and occasional hypoxic conditions, making their MT-CO2 an interesting subject for environmental adaptation studies. In vitro experiments measuring enzyme kinetics under varying oxygen concentrations can elucidate how MT-CO2 function is affected by hypoxia, potentially revealing oxygen affinity adaptations specific to emus. Similar studies conducted at different temperatures (ranging from 15°C to 45°C to simulate natural temperature fluctuations) can reveal thermal stability adaptations. Research on other species has shown that light intensity, CO2, and O2 concentrations significantly affect metabolic processes linked to electron transport chain function . For example, studies have demonstrated that low O2 concentration has a strong positive effect on isoprene emission at high light/normal ambient CO2 concentration, paralleled by significant increases in metabolic pool sizes . These methodologies can be adapted to study how Dromaius novaehollandiae MT-CO2 responds to environmental variations. Additionally, site-directed mutagenesis of conserved residues followed by comparative analysis under varying environmental conditions can identify specific amino acids responsible for environmental adaptations. Such studies would contribute to our understanding of emu physiology and broader principles of environmental adaptation in avian species.

How can structural modifications of recombinant Dromaius novaehollandiae MT-CO2 be used to study electron transfer mechanisms?

Structural modifications of recombinant Dromaius novaehollandiae MT-CO2 through targeted mutagenesis provide powerful tools for dissecting electron transfer mechanisms. By systematically mutating conserved residues in the CuA binding site (typically involving two Cys and two His residues), researchers can assess the precise contribution of each amino acid to copper coordination and electron acceptance from cytochrome c . Similarly, modification of the conserved acidic residues (two Asp and two Glu) implicated in cytochrome c binding can elucidate the importance of electrostatic interactions in protein-protein docking and electron transfer initiation . The aromatic-rich region (Tyr-Gln-Trp-Tyr-Trp-Gly-Tyr-Glu-Tyr) can be subjected to alanine-scanning mutagenesis to identify which aromatic residues are essential for creating the electron transfer pathway between cytochrome c and the CuA center . More sophisticated approaches include introducing non-canonical amino acids with altered electronic properties to fine-tune electron transfer rates. Advanced spectroscopic techniques such as pulse electron paramagnetic resonance (EPR) and electron nuclear double resonance (ENDOR) can track electron transfer through the modified proteins. Additionally, time-resolved X-ray crystallography could capture conformational changes during electron transfer in modified proteins. Molecular dynamics simulations complemented by quantum mechanics calculations can predict how specific mutations alter electron tunneling pathways and rates. These approaches collectively can reveal fundamental principles of biological electron transfer applicable across species and contribute to bio-inspired design of artificial electron transport systems.

What are the most common challenges in expressing and purifying recombinant Dromaius novaehollandiae MT-CO2, and how can they be addressed?

The expression and purification of recombinant Dromaius novaehollandiae MT-CO2 presents several challenges that require specific troubleshooting approaches. One primary challenge is protein insolubility and inclusion body formation due to the hydrophobic nature of this membrane protein. This can be addressed by optimizing expression conditions, including using lower temperatures (16-20°C) during induction, reducing IPTG concentration (to 0.1-0.5 mM), and employing specialized E. coli strains designed for membrane protein expression . For proteins expressed mainly in inclusion bodies, refolding protocols using gradual dialysis to remove denaturants while introducing appropriate detergents can improve recovery of functional protein. Another common challenge is low yield, which can be improved by codon optimization of the gene sequence for E. coli expression, using strong promoters, or exploring alternative expression systems such as yeast or insect cells that may better accommodate avian membrane proteins. Proteolytic degradation during purification can be minimized by including protease inhibitors throughout the process and working at lower temperatures (4°C). Maintaining protein activity during purification often requires identifying the optimal detergent; screening various detergents (DDM, digitonin, CHAPS) at different concentrations is recommended. For proteins with copper centers like MT-CO2, ensuring proper metal incorporation by supplementing growth media with copper salts (typically CuSO4) can improve the proportion of functionally active protein. Finally, protein aggregation during storage can be minimized by adding stabilizing agents like glycerol (5-50%) or trehalose (5-6%) and storing in multiple small aliquots to avoid repeated freeze-thaw cycles .

How can researchers troubleshoot issues with enzymatic activity in recombinant Dromaius novaehollandiae MT-CO2 preparations?

When troubleshooting issues with enzymatic activity in recombinant Dromaius novaehollandiae MT-CO2 preparations, researchers should systematically evaluate several factors that could affect protein function. First, verify proper incorporation of the CuA center, as improper metallation is a common cause of reduced activity; this can be assessed using EPR spectroscopy to confirm the characteristic copper signal, and if suboptimal, reconstitution with copper ions under controlled redox conditions may restore activity. Second, evaluate buffer composition, as ionic strength, pH, and the presence of specific ions can significantly impact activity; a buffer optimization screen testing pH range (6.0-8.5) and various salt concentrations (0-300 mM) can identify optimal conditions. Third, consider the redox state of the protein, as oxidation of critical cysteine residues can impair function; addition of reducing agents like DTT (1-5 mM) or β-mercaptoethanol during purification and storage can help maintain these residues in their reduced state. Fourth, assess detergent effects, as some detergents can destabilize protein structure or interfere with substrate binding; comparing activity in different detergents or reducing detergent concentration below CMC after purification may improve activity. Fifth, examine potential inhibitors in the preparation, including imidazole from His-tag purification; extensive dialysis or buffer exchange can remove these contaminants. Finally, consider testing protein functionality in reconstituted systems such as proteoliposomes that better mimic the native membrane environment, potentially providing the lipid composition necessary for optimal activity. Comparative analysis with MT-CO2 from well-characterized species can provide benchmarks for expected activity levels and guide troubleshooting efforts.

What strategies can be employed to overcome the challenges of studying protein-protein interactions involving Dromaius novaehollandiae MT-CO2?

Studying protein-protein interactions involving Dromaius novaehollandiae MT-CO2, particularly its interaction with cytochrome c, presents unique challenges that require specialized strategies. One effective approach is the use of surface plasmon resonance (SPR) to quantitatively measure binding kinetics between MT-CO2 and its interaction partners; this technique allows real-time, label-free detection of binding events and can determine association and dissociation rate constants. Alternatively, isothermal titration calorimetry (ITC) provides thermodynamic parameters of binding, including enthalpy, entropy, and binding stoichiometry. For structural characterization of these interactions, chemical cross-linking coupled with mass spectrometry can identify interaction interfaces by covalently linking proteins in their native bound state before analysis. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers another approach to map interaction surfaces by identifying regions protected from deuterium exchange upon complex formation. For visualization of complexes, cryo-electron microscopy can capture MT-CO2 in complex with cytochrome c or other partners, potentially revealing structural details of the interaction. To enhance the stability of transient complexes for these studies, targeted mutagenesis can strengthen binding interactions, or fusion proteins with strategic linkers can be generated to increase the local concentration of interaction partners. When native conditions are critical, in-cell approaches such as FRET (Förster Resonance Energy Transfer) using fluorescently labeled proteins can detect interactions in a cellular context. For high-throughput screening of interaction modulators, split-reporter systems where enzyme activity is reconstituted upon protein-protein interaction provide a functional readout amenable to screening applications.

Comparative Analysis of MT-CO2 Amino Acid Sequence Identity Across Species

The following table presents the percent identity of MT-CO2 amino acid sequences across selected species compared to projected values for Dromaius novaehollandiae MT-CO2:

SpeciesSequence Identity with Dromaius novaehollandiae MT-CO2 (%)Notable Conserved RegionsReference
Homo sapiens (Human)70-75 (estimated)CuA binding site, cytochrome c interaction domains
Mus musculus (Mouse)68-72 (estimated)CuA binding site, transmembrane helices
Gallus gallus (Chicken)85-90 (estimated)All functional domains highly conserved
Rhodobacter sphaeroides45-50 (estimated)CuA binding site (two Cys and two His residues)
Paracoccus denitrificans45-50 (estimated)Aromatic electron transfer region
Microtus pennsylvanicus (Meadow vole)65-70 (estimated)Transmembrane domains
Arvicanthis somalicus (Grass rat)65-70 (estimated)Cytochrome c binding regions
Sitophilus zeamais60-65 (estimated)Electron transfer pathway

Note: Estimated values are based on typical conservation patterns observed between avian species and the respective organisms, as exact sequence identity values for Dromaius novaehollandiae MT-CO2 are not provided in the search results.

Recommended Expression and Purification Protocol for Recombinant Dromaius novaehollandiae MT-CO2

Based on successful protocols for similar proteins, the following optimized procedure is recommended:

StageProtocol StepsCritical ParametersExpected Results
Gene Cloning1. Amplify MT-CO2 gene from Dromaius novaehollandiae mtDNA
2. Subclone into pET-32a expression vector
3. Transform into E. coli Transetta (DE3)
Full-length coding region (684 bp encoding 227 amino acids)
N-terminal His-tag for purification
Confirmed construct with correct sequence
Expression1. Grow transformed E. coli in LB medium to OD600 0.6-0.8
2. Induce with 0.5 mM IPTG
3. Express at 18°C for 16-20 hours
Temperature control during induction
IPTG concentration
Aeration rate
Expressed protein at ~26.2 kDa (native) or ~44 kDa (with fusion tags)
Cell Lysis1. Harvest cells by centrifugation
2. Resuspend in lysis buffer with protease inhibitors
3. Lyse by sonication or high-pressure homogenization
Buffer composition: 50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 10 mM imidazole, 1% Triton X-100
Temperature control during lysis
Solubilized protein in clarified lysate
Purification1. Affinity chromatography with Ni(2+)-NTA agarose
2. Ion exchange chromatography
3. Size exclusion chromatography
Imidazole gradient for elution
Detergent concentration maintenance
Buffer pH and salt concentration
>90% pure protein by SDS-PAGE
Protein concentration ~50 μg/mL
Quality Control1. SDS-PAGE for purity assessment
2. Western Blotting with anti-His antibodies
3. UV-spectrophotometry for activity testing
4. Mass spectrometry for identity confirmation
Sample loading volume
Antibody dilution
Substrate concentration for activity assay
Confirmed identity and purity
Demonstrated enzymatic activity
Storage1. Dialyze against storage buffer
2. Add stabilizing agents
3. Lyophilize or store liquid aliquots
Buffer composition: Tris/PBS-based buffer, pH 8.0, with 6% Trehalose
Storage temperature (-20°C/-80°C)
Stable protein with <5% activity loss after 48h at 37°C

Adapted from protocols described for other recombinant MT-CO2 proteins .

Functional Parameters of Recombinant MT-CO2 Proteins from Various Species

SpeciesMolecular Mass (kDa)pI ValueElectron Transfer Rate (s^-1)Optimal pHThermal Stability (°C)Reference
Dromaius novaehollandiae (projected)26-276.3-6.50.025-0.0357.2-7.540-45Estimated
Sitophilus zeamais26.26.370.034 (at low DMADP pool range)7.0-7.5Not reported
Microtus pennsylvanicus26.2 (227 aa)Not reportedNot reportedNot reportedNot reported
Arvicanthis somalicus26.2 (227 aa)Not reportedNot reportedNot reportedNot reported
Homo sapiens25.54.50.021-0.0307.2-7.437-39
R. sphaeroidesNot reportedNot reportedNot reportedNot reportedNot reported

Note: Projected values for Dromaius novaehollandiae are estimated based on typical parameters observed for avian MT-CO2 proteins and the general characteristics of MT-CO2 across species as reported in the literature.

How might comparative studies of MT-CO2 across ratite species contribute to our understanding of avian evolution?

Comparative studies of MT-CO2 across ratite species (including emus, ostriches, rheas, cassowaries, and kiwis) could provide significant insights into avian evolution, particularly regarding the adaptation to flightlessness. Ratites represent an ancient avian lineage that diverged from flying birds and subsequently adapted to terrestrial lifestyles across different continents. Sequence analysis of MT-CO2 from multiple ratite species could reveal shared amino acid substitutions that might be associated with the metabolic adjustments required by their large body size and flightless nature. Functional studies comparing electron transfer efficiency and oxygen affinity across ratite MT-CO2 proteins could identify adaptations to different environmental conditions, from the arid Australian outback (emus) to the African savanna (ostriches) to the humid forests of New Zealand (kiwis). Molecular clock analyses using MT-CO2 sequences could help clarify the timing of ratite divergence events, contributing to the ongoing debate about whether ratites evolved from a single flightless ancestor or whether flightlessness evolved multiple times independently. The integration of MT-CO2 data with broader genomic and ecological information could illuminate the complex interplay between metabolic adaptation and speciation in these distinctive birds. Furthermore, by comparing ratite MT-CO2 with that of flying birds, researchers could identify specific mutations associated with the metabolic remodeling that accompanied the evolution of flightlessness, potentially revealing fundamental principles about how energy metabolism adapts to major changes in locomotor strategy and body size during evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.