Recombinant Drosophila algonquin Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Description

General Information

  • Recommended Name: Cytochrome c oxidase subunit 2

  • EC Number: 1.9.3.1

  • Alternative Name: Cytochrome c oxidase polypeptide II

  • Species: Drosophila algonquin (Fruit fly)

  • Product Code: CSB-EP015073DFN1

  • UniProt No.: P84201

  • Protein Length: Partial

  • Source: E. coli

  • Purity: >85% (SDS-PAGE)

  • Tag Info: Tag type determined during manufacturing

Function and Significance

Cytochrome c oxidase (COX), also known as Complex IV, is the terminal enzyme of the electron transport chain in mitochondria . It catalyzes the transfer of electrons from cytochrome c to molecular oxygen, reducing oxygen to water and creating a proton gradient across the inner mitochondrial membrane, which drives ATP synthesis . Subunit 2 (COII) is a key component of this enzyme complex, involved in electron transfer and binding .

Gene Structure and Characteristics

In Drosophila, the COII gene is located in the mitochondrial DNA (mtDNA) . The gene order and transcription direction are similar to those in other Drosophila species . The Drosophila obscura group, which includes D. algonquin, has a COII gene consisting of 688 nucleotides, encoding 229 amino acids plus the initial T of the termination codon . Drosophila COII gene sequences have a high proportion of A+T (73%-75%), due to a low frequency of codons ending in G or C .

Applications in Research

Recombinant Drosophila algonquin Cytochrome c oxidase subunit 2 (mt:CoII) is used in various research applications:

  • Phylogenetic Studies: COII gene sequences are used to infer phylogenetic relationships among Drosophila species .

  • ELISA assays: Recombinant proteins can be used as antigens in Enzyme-Linked Immunosorbent Assays (ELISA) .

  • Studies of Molecular Evolution: Examining the sequence divergence and evolutionary rates of the COII gene helps understand the molecular evolution of Drosophila and other insects .

  • Analysis of Mitochondrial Function: Recombinant COII can be used to study the structure, function, and regulation of cytochrome c oxidase .

Phylogenetic Analysis

Phylogenetic analyses using COII sequences have provided insights into the relationships within the Drosophila obscura species group . The COII gene has been used, in conjunction with other genes, to reconstruct the phylogeny of Drosophila species . These analyses help to resolve the evolutionary relationships between different Drosophila subgroups .

Sequence Divergence

Sequence divergence analysis of the COII gene reveals variations among different Drosophila species . Corrected divergences are calculated for all pairwise combinations of species, with the number of transition and transversion differences analyzed . These data provide a quantitative measure of the genetic distances between species and contribute to understanding their evolutionary relationships .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila algonquin (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNVEFDS YMIPTNELANDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISNSVNS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising Complexes I-IV (and Complex II), facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center (subunit 2) and heme a (subunit 1) to the binuclear center (BNC) in subunit 1, comprising heme a3 and CuB. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Cytochrome c oxidase subunit 2 (mt:CoII) in Drosophila algonquin?

    Cytochrome c oxidase subunit 2 (mt:CoII) is a mitochondrial-encoded protein that forms a critical component of complex IV in the mitochondrial respiratory chain. It is encoded by the mitochondrial DNA and plays an essential role in electron transport and oxidative phosphorylation . The protein contains copper-binding sites necessary for its function in electron transfer from cytochrome c to molecular oxygen. In recombinant form, mt:CoII is produced with high purity (typically >85% as determined by SDS-PAGE) for use in research applications requiring purified protein .

  • How does mt:CoII function in the mitochondrial respiratory chain?

    mt:CoII functions as an integral component of cytochrome c oxidase (COX), which is the terminal enzyme of the mitochondrial electron transport chain. The protein contains the CuA center that receives electrons from cytochrome c and transfers them to other subunits of the complex . This electron transfer is coupled to proton pumping across the inner mitochondrial membrane, contributing to the proton gradient that drives ATP synthesis.

    The assembly of functional cytochrome c oxidase requires metallochaperones like SCO proteins, which are involved in copper transport to the CuA site . Disruption of mt:CoII function can lead to decreased cytochrome c oxidase activity, impairing oxidative phosphorylation and cellular energy production, with tissue-specific consequences depending on energy requirements .

  • What evolutionary significance does mt:CoII have in Drosophila species?

    mt:CoII has significant evolutionary importance in Drosophila studies for several reasons:

    • As a mitochondrial gene, it evolves at a relatively fast rate compared to nuclear genes, making it valuable for phylogenetic studies of closely related species

    • It has been extensively used in species delimitation studies using multispecies coalescent analysis to determine species boundaries

    • Genetic distances calculated from mt:CoII sequences (such as Jukes-Cantor distances) correlate with measures of reproductive isolation, providing insights into speciation processes

    • The gene contains informative variation that can be used to construct evolutionary relationships among Drosophila species

    Research has shown that coalescent-based species delimitation using mt:CoII and other genes is concordant with reproductive isolation-based methods for approximately 77% of Drosophila species pairs, indicating its utility in evolutionary studies .

  • What are the optimal production methods for recombinant mt:CoII?

    Based on available product information, recombinant mt:CoII is typically produced using the following methods:

    • Expression systems: E. coli is commonly used, though yeast, baculovirus-infected insect cells, or mammalian cell systems are alternative options depending on research requirements

    • Construct design: The mt:CoII gene may be expressed as a full-length protein or as a partial sequence with appropriate fusion tags to facilitate purification

    • Purification: Affinity chromatography is typically employed, yielding protein with >85-90% purity as determined by SDS-PAGE

    • Formulation: The purified protein is supplied in liquid form containing glycerol or as a lyophilized powder for improved stability

    When designing expression constructs, researchers should consider codon optimization for the expression host and the addition of purification tags that minimize interference with protein function .

  • What are the recommended storage and handling protocols for recombinant mt:CoII?

    For optimal results with recombinant mt:CoII, the following storage and handling protocols are recommended:

    ParameterRecommendation
    Long-term storage-20°C or -80°C
    Liquid formulation shelf lifeApproximately 6 months at -20°C/-80°C
    Lyophilized form shelf lifeApproximately 12 months at -20°C/-80°C
    ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
    Stabilizing additives5-50% glycerol (final concentration)
    Working storage4°C for up to one week
    Freeze-thaw cyclesMinimize; aliquot before freezing
    Pre-use preparationBrief centrifugation to bring contents to bottom of vial

    These recommendations are based on standard protocols for recombinant proteins and specific information provided by suppliers of recombinant Drosophila algonquin mt:CoII .

Advanced Research Questions

  • What methods are most effective for introducing mutations in mt:CoII in Drosophila?

    Several approaches have been developed for introducing mutations in mitochondrial genes like mt:CoII in Drosophila:

    a) Targeted restriction enzyme approach: This method involves expressing mitochondria-targeted restriction enzymes in the germline to create specific cleavage sites in mtDNA. While compromising fertility, this approach yields "escaper" progeny that carry homoplasmic mtDNA mutations lacking the cleavage site . This technique has been successfully used to create mutations in the related cytochrome c oxidase gene mt:CoI.

    b) Experimental evolution strategy: This approach prevents females from mating with their male siblings, instead mating them with males from an external stock each generation. This creates permissive conditions for male-harming mtDNA mutations to accumulate and persist, as demonstrated with the COII G177S mutation .

    c) Complementary approaches:

    • Chemical mutagenesis followed by backcrossing to replace nuclear genes while transmitting mtDNA mutations

    • Employing a mutator mtDNA polymerase to increase mtDNA mutation rates

    • Combining crossing schemes with targeted restriction endonuclease strategies

    The targeted restriction enzyme approach appears to be the most direct and controlled method for generating specific mtDNA mutations in genes like mt:CoII .

  • How do mutations in mt:CoII specifically affect male fertility in Drosophila?

    The COII G177S mutation provides an excellent model for understanding how mt:CoII mutations can specifically affect male fertility:

    • This mutation causes an age- and temperature-dependent decrease in male fertility without affecting other phenotypic traits in males or females

    • The fertility defect correlates with a decrease in COII enzymatic activity

    • Cellular characterization reveals decreased sperm production and impaired sperm function in affected males

    • The fertility defect can be completely suppressed by diverse nuclear backgrounds from various D. melanogaster strains, demonstrating cyto-nuclear genetic interactions

    These findings highlight the stringent requirements for optimal mitochondrial function during spermatogenesis and sperm function. The male-specific effects provide evidence for the "mother's curse" hypothesis, where mtDNA mutations that are neutral in females but harmful to males can persist in populations due to maternal inheritance of mitochondria .

  • What approaches can be used to study cyto-nuclear interactions involving mt:CoII?

    Several experimental approaches have proven effective for studying cyto-nuclear interactions involving mt:CoII:

    a) Introgression experiments: Creating lines with the same mt:CoII mutation but different nuclear backgrounds through controlled backcrossing. This approach revealed that the fertility defect in COII G177S males could be suppressed by diverse nuclear backgrounds .

    b) Experimental evolution: Creating conditions where selection against male-harming mtDNA mutations is relaxed by preventing females from mating with their male siblings .

    c) Phenotypic characterization: Measuring traits such as:

    • Male fertility across different ages and temperatures

    • Sperm production and function

    • COII enzymatic activity

    • Other potential phenotypes (development, neurodegeneration, muscle function)

    d) Environmental manipulation: Assessing how temperature and other environmental factors interact with mt:CoII mutations and different nuclear backgrounds .

    These approaches can identify compensatory nuclear variants and elucidate mechanisms of cyto-nuclear co-evolution in response to mt:CoII mutations.

  • How can mt:CoII sequences be effectively used in species delimitation studies?

    mt:CoII sequences have proven valuable for species delimitation in Drosophila through several methodological approaches:

    a) Multispecies coalescent (MSC) analysis: mt:CoII sequence data can be incorporated into MSC analyses using software like BPP (Bayesian Phylogenetics and Phylogeography) .

    b) Prior calibration: Researchers should consider both:

    • Empirically "informed" priors derived from the data

    • "Uninformed" priors based on general expectations about population size and divergence time

    c) Implementation protocol:

    • Sequence alignment using tools like MUSCLE

    • File conversion to appropriate formats using tools like DendroPy

    • Running delimitation analyses under multiple prior settings

    • Extracting posterior values and summarizing distributions

    d) Validation: Compare coalescent-based species boundaries with those determined by reproductive isolation measures. Research shows 77% concordance between these methods for Drosophila species pairs .

    When using mt:CoII for species delimitation, researchers should be aware that mitochondrial genes share a single coalescent history, so including multiple mitochondrial genes does not provide independent evolutionary evidence .

  • What are the technical challenges in isolating functional recombinant mt:CoII for in vitro assays?

    Producing functional recombinant mt:CoII presents several technical challenges:

    ChallengeDescriptionPotential Solutions
    Expression system selectionSelecting a system that can properly express a mitochondrial membrane proteinTest multiple systems (E. coli, yeast, baculovirus, mammalian cells); optimize expression conditions
    Protein foldingEnsuring proper folding outside the native membrane environmentInclude appropriate detergents or lipid environments; co-express with chaperones
    Metal cofactor incorporationIncorporating copper centers essential for functionSupplement growth media with copper; co-express with metallochaperones
    Enzymatic activity preservationMaintaining catalytic activity when isolated from the complexOptimize purification conditions to minimize denaturation; consider co-expressing other subunits
    Stability issuesPreventing degradation and maintaining structural integrityInclude stabilizing additives like glycerol; store at -20°C/-80°C; avoid freeze-thaw cycles
    Purity requirementsAchieving high purity while preserving functionOptimize purification protocols; validate purity by SDS-PAGE (>85-90%)

    Based on commercial product information, successful production has been achieved in E. coli, with proteins formulated in glycerol-containing buffers and stored at -20°C/-80°C .

  • How does the COII G177S mutation specifically affect sperm development and function?

    The COII G177S mutation provides insights into the critical role of mitochondrial function in sperm development:

    a) Biochemical effects:

    • Decreased COII enzymatic activity, impairing cytochrome c oxidase function

    • Likely reduction in ATP production in developing sperm and mature sperm

    b) Developmental effects:

    • Reduced sperm production, indicating disruption of spermatogenesis

    • Potentially affecting mitochondrial dynamics during sperm development

    c) Functional impairments:

    • Defects in mature sperm function, potentially including motility defects

    • These defects become more pronounced with:

      • Increased age of males

      • Higher temperatures (suggesting increased metabolic stress)

    d) Specificity of effects:

    • Remarkably, no other phenotypic traits are affected

    • This highlights the particular sensitivity of spermatogenesis to mitochondrial function

    e) Nuclear compensation:

    • The fertility defect can be suppressed by certain nuclear backgrounds

    • This suggests that nuclear-encoded proteins can compensate for the mt:CoII dysfunction

    This mutation demonstrates how seemingly subtle changes in mitochondrial proteins can have dramatic tissue-specific effects, particularly in high-energy-demanding processes like spermatogenesis.

  • What methods can be used to measure COII enzymatic activity in Drosophila?

    While specific methodological details aren't fully described in the source material, several approaches can be used to measure COII enzymatic activity:

    a) Cytochrome c oxidase activity assays:

    • Spectrophotometric monitoring of reduced cytochrome c oxidation

    • Typically measured as a decrease in absorbance at 550 nm

    • Can be performed on isolated mitochondria or tissue homogenates

    b) Oxygen consumption measurements:

    • Using oxygen electrodes or fluorescence-based oxygen sensors

    • Measuring respiratory capacity in the presence of specific substrates and inhibitors

    • Can be performed on isolated mitochondria, permeabilized cells, or tissue samples

    c) Tissue-specific analysis:

    • Given the specific effects on male fertility, isolation of testis tissue for specific analysis

    • Comparison of COII activity in reproductive tissues versus other body tissues

    d) Comparative approach:

    • Analysis across different genotypes (wild-type vs. COII G177S)

    • Testing at different temperatures to assess temperature sensitivity

    • Measurement at different ages to assess age-dependent effects

    These methods should be calibrated against wild-type controls to determine relative changes in enzymatic activity associated with specific mutations.

  • How do temperature and aging affect the phenotypic expression of mt:CoII mutations?

    The study of COII G177S reveals important insights into how temperature and aging modulate the phenotypic expression of mt:CoII mutations:

    a) Temperature effects:

    • COII G177S males show more pronounced fertility defects at higher temperatures

    • This temperature sensitivity likely reflects:

      • Increased metabolic demand at higher temperatures

      • Greater reliance on efficient mitochondrial function

      • Possible thermal instability of the mutant protein

    b) Aging effects:

    • The fertility defects in COII G177S males become more severe with age

    • This age dependency may result from:

      • Cumulative damage to mitochondria over time

      • Reduced compensatory capacity with age

      • Progressive decline in energy production capacity

    c) Experimental approaches:

    • Temperature-controlled fertility assays at different male ages

    • Measurement of COII enzymatic activity across temperatures and ages

    • Assessment of sperm production and function under various conditions

    These findings demonstrate how environmental factors and biological processes can unmask or exacerbate phenotypic effects of mitochondrial mutations that might be compensated under optimal conditions.

  • What are the current approaches for using mitochondrial restriction enzymes to create mt:CoII mutations?

    Based on successful applications with related mitochondrial genes, the following approach can be used to generate mutations in mt:CoII:

    a) Experimental setup:

    • Engineer restriction enzymes with mitochondrial targeting sequences

    • Design constructs to express these enzymes specifically in the Drosophila germline

    • Select restriction enzymes that recognize sequences within the mt:CoII gene

    b) Selection strategy:

    • Expression of the targeted restriction enzymes compromises fertility

    • "Escaper" progeny carry homoplasmic mtDNA mutations that eliminate the restriction site

    • These mutations may include various substitutions that alter the recognition sequence

    c) Mutation characterization:

    • Sequence verification of the mutations

    • Assessment of phenotypic effects, which may range from:

      • Healthy/wild-type-like phenotypes (as in mt:CoI(A302T))

      • Specific defects (like male sterility in mt:CoI(R301L))

      • Severe, pleiotropic defects (as in mt:CoI(R301S), which showed growth retardation, neurodegeneration, muscular atrophy, male sterility, and reduced lifespan)

    This approach has been successfully applied to generate mutations in mt:CoI and could be adapted specifically for mt:CoII, enabling the creation of mitochondrial mutants for functional studies .

  • How do the genetic code differences in Drosophila mt:CoII impact evolutionary studies?

    Drosophila mitochondrial genes, including mt:CoII, show important genetic code variations that impact evolutionary analyses:

    a) Codon usage differences:

    • In Drosophila yakuba mtDNA, the AGA triplet is used to specify amino acids in COII and other mitochondrial genes

    • These AGA codons correspond to positions specifying nine different amino acids in equivalent genes from mouse, yeast, and Zea mays, but never arginine

    b) Methodological implications:

    • When conducting comparative analyses, researchers must account for these genetic code differences

    • Standard translation tables may not apply across all species

    • Codon-based models of sequence evolution should incorporate appropriate genetic codes

    c) Evolutionary significance:

    • These differences represent distinct evolutionary trajectories in mitochondrial genetic codes

    • They may affect rates and patterns of molecular evolution

    • They provide insights into the co-evolution of mitochondrial and nuclear genomes

    d) Practical considerations for mt:CoII studies:

    • Use mitochondrial-specific translation tables when analyzing protein sequences

    • Consider codon bias when designing expression constructs for recombinant production

    • Be aware of potential misinterpretations in cross-species comparisons

    These genetic code variations add complexity to evolutionary studies but also provide valuable information about the unique evolutionary history of Drosophila mitochondrial genes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.