Recombinant Drosophila ambigua Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Drosophila ambigua Cytochrome c Oxidase Subunit 2 (mt:CoII)

Drosophila ambigua Cytochrome c Oxidase subunit II (mt:CoII), is a mitochondrial protein that is a component of the respiratory chain . More specifically, it is a subunit of the cytochrome c oxidase complex, also known as Complex IV . This complex is essential for cellular respiration, catalyzing the final step in the electron transport chain by transferring electrons to oxygen, generating water, and creating a proton gradient that drives ATP synthesis .

Recombinant Drosophila ambigua Cytochrome c Oxidase subunit II (mt:CoII) refers to the protein produced using recombinant DNA technology, where the gene encoding the Drosophila ambigua Cytochrome c Oxidase subunit II (mt:CoII) is cloned and expressed in a host organism to produce large quantities of the protein for research or industrial purposes .

Structure and Function

Cytochrome c oxidase (COX) is a large, multi-subunit enzyme complex found in the mitochondria of eukaryotic cells and some bacteria . It plays a crucial role in cellular respiration by catalyzing the transfer of electrons from cytochrome c to molecular oxygen . This process is coupled with the pumping of protons across the inner mitochondrial membrane, contributing to the generation of an electrochemical gradient that drives ATP synthesis .

Drosophila COX, like that of other organisms, comprises several subunits, each with specific roles in the enzyme's structure and function . Subunit II (mt:CoII) is one of the core subunits of the COX complex, and it contains two copper centers (CuA and CuB) that are essential for electron transfer .

Data Tables

The following tables present data related to Drosophila ambigua Cytochrome c Oxidase subunit II (mt:CoII) from various research studies.

Table 1: Amino Acid Composition of Drosophila obscura COII Gene

Amino AcidFrequency
Leucine30
OtherVaries

Table 2: PCR Primer Sequences for COI Amplification in D. gallinae

Primer NameSequence (5' to 3')
COI1Fyuw114AGATCTTTAATTGAAGGGG
COI1Ryuw114AAGATCAAAGAATCGGTGG

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If a specific tag is required, please inform us for preferential development.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila ambigua (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNIEFDS YMIPTNELSNDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISNSVNS
Uniprot No.

Target Background

Function
Drosophila ambigua Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain consists of three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 in Drosophila ambigua and how does it compare to other Drosophila species?

Cytochrome c oxidase subunit 2 (mt:CoII) is a mitochondrially-encoded protein that forms part of the cytochrome c oxidase complex (Complex IV) in the electron transport chain, critical for cellular respiration. In Drosophila ambigua, this protein functions similarly to its counterparts in related species but exhibits sequence variations that can be used for phylogenetic studies. Research demonstrates that mitochondrial genes like mt:CoII serve as effective markers for evolutionary studies due to their relatively high mutation rates compared to nuclear genes.

The sequence variation between D. ambigua and related species like D. obscura makes mt:CoII valuable for evolutionary studies. When analyzing mitochondrial DNA, researchers commonly use D. ambigua as an outgroup for comparative studies with other Drosophila species such as D. obscura . This approach helps establish evolutionary relationships and divergence times between species. Sequence analysis indicates that while the functional domains of mt:CoII are conserved across Drosophila species, specific nucleotide variations can be used to distinguish D. ambigua from other members of the obscura group.

What are the standard protocols for isolating and amplifying mt:CoII from Drosophila ambigua?

Successful isolation and amplification of mt:CoII from D. ambigua typically follows protocols similar to those used for other mitochondrial genes in Drosophila species. The procedure involves:

  • DNA extraction from whole flies or tissue samples

  • PCR amplification with gene-specific primers

  • Purification of PCR products

  • Sequencing and verification

For PCR amplification, researchers can adapt protocols similar to those used for other mitochondrial genes such as Cyt b. A typical PCR cycling protocol would include an initial denaturation step at 94°C for 3 minutes, followed by 35 cycles of: denaturation at 94°C for 50 seconds, annealing at approximately 52°C for 1 minute, and extension at 72°C for 1 minute, with a final extension at 72°C for 3 minutes . Primers should be designed specifically for D. ambigua mt:CoII based on conserved regions flanking the gene.

After amplification, PCR products should be purified using commercial kits such as the QIAquick PCR Purification kit before sequencing . Sequence verification typically involves bidirectional sequencing and alignment using software like BioEdit with the ClustalW algorithm to ensure accuracy.

What expression systems are most effective for producing recombinant D. ambigua mt:CoII?

Producing functional recombinant mt:CoII presents unique challenges due to its mitochondrial origin and hydrophobic nature. The most effective expression systems balance protein yield with proper folding and post-translational modifications. While the search results don't specifically address expression systems for D. ambigua mt:CoII, general approaches for mitochondrial membrane proteins can be applied.

Bacterial expression systems (E. coli):

  • Advantages: High yield, simple manipulation, cost-effective

  • Limitations: Lack post-translational modifications, often produce inclusion bodies requiring refolding

  • Optimization: Use specialized strains (e.g., C41/C43) designed for membrane proteins; fusion tags like MBP improve solubility

Insect cell expression systems:

  • Advantages: More similar to native Drosophila environment, better post-translational modifications

  • Limitations: Higher cost, more complex methodology

  • Optimization: Baculovirus expression vectors with Sf9 or High Five cells

Yeast expression systems:

  • Advantages: Eukaryotic processing machinery, membrane integration capability

  • Limitations: Potential glycosylation differences

  • Optimization: Pichia pastoris offers strong inducible promoters and growth to high cell densities

When selecting an expression system, researchers should consider whether functional activity or structural studies are the primary goal. For functional studies of recombinant mt:CoII, maintaining native-like folding is critical, whereas structural studies may prioritize higher yield and purity.

How can targeted mutations be introduced into recombinant D. ambigua mt:CoII for structure-function studies?

Introducing targeted mutations into recombinant D. ambigua mt:CoII enables structure-function studies that can reveal important insights about protein function, evolution, and disease mechanisms. Several approaches have been developed based on techniques used in other Drosophila mitochondrial genes.

Site-directed mutagenesis represents the most straightforward approach for introducing specific mutations. This typically involves PCR-based methods using primers containing the desired mutations. For more extensive alterations, overlap extension PCR can be employed to replace entire regions of the gene.

For in vivo studies, targeted manipulation of the mitochondrial genome presents additional challenges due to the high copy number and random segregation of mtDNA . One innovative approach developed for Drosophila involves targeting restriction enzymes to mitochondria in the germline:

  • Design a construct expressing a restriction enzyme targeting a specific site in mt:CoII

  • Direct the enzyme to mitochondria using appropriate targeting sequences

  • Express in the germline to create selection pressure against wild-type sequences

  • Isolate escaper progeny that carry homoplasmic mtDNA mutations lacking the cleavage site

This approach has successfully generated mitochondrial mutations in other genes such as mt:CoI, resulting in phenotypes ranging from mild to severe depending on the specific mutation . A similar strategy could be adapted for mt:CoII studies, potentially generating an array of mutants with varying functional impairments.

What phenotypic effects can be expected from mutations in D. ambigua mt:CoII?

Mutations in mitochondrial genes like mt:CoII can produce a wide spectrum of phenotypic effects depending on the nature and location of the mutation. Based on studies of mutations in related mitochondrial genes such as mt:CoI, researchers can anticipate various outcomes when manipulating mt:CoII.

Research on mt:CoI mutations in Drosophila has shown that different mutations in the same gene can produce dramatically different phenotypes. For example, the mt:CoI(A302T) mutation was found to be essentially healthy, while mt:CoI(R301L) caused male sterility but was otherwise healthy. In contrast, mt:CoI(R301S) resulted in multiple severe defects including growth retardation, neurodegeneration, muscular atrophy, male sterility, and reduced lifespan .

Similar variability might be expected with mt:CoII mutations, where:

  • Silent or conservative mutations in non-critical regions may produce no observable phenotype

  • Mutations affecting protein-protein interactions within Complex IV might impair assembly but maintain some function

  • Mutations in catalytic residues could completely abolish enzymatic activity

  • Mutations affecting protein stability might lead to reduced protein levels and partial deficiency

The phenotypic consequences would likely manifest primarily in high-energy demanding tissues such as muscles and neurons, potentially causing defects in movement, fertility, and lifespan. These phenotypes can be quantified using standardized assays for Drosophila locomotion, lifespan measurement, and fertility testing.

What PCR and sequencing strategies are most reliable for analyzing D. ambigua mt:CoII?

Reliable PCR and sequencing strategies for D. ambigua mt:CoII require careful optimization of several parameters to ensure accurate and reproducible results. Based on protocols used for other Drosophila mitochondrial genes, the following approach is recommended:

PCR Protocol Optimization:

  • Primer design: Design species-specific primers based on conserved regions flanking mt:CoII. Include at least 20-25 nucleotides with appropriate GC content (40-60%) and similar melting temperatures.

  • PCR cycling conditions: Start with conditions similar to those used for Cyt b amplification:

    • Initial denaturation: 94°C for 3 minutes

    • 35 cycles of:

      • Denaturation: 94°C for 50 seconds

      • Annealing: 51-53°C for 1 minute (optimize as needed)

      • Extension: 72°C for 1 minute

    • Final extension: 72°C for 3 minutes

  • Template quality: Use high-quality DNA to avoid nuclear mitochondrial DNA segments (NUMTs) contamination.

Sequencing Strategy:

  • Purify PCR products using a commercial kit (e.g., QIAquick PCR Purification kit)

  • Perform bidirectional sequencing using both forward and reverse primers to ensure complete coverage

  • Align sequences using software such as BioEdit with the ClustalW algorithm

  • Verify sequence quality by examining chromatograms for ambiguous peaks

  • Compare sequences with known mt:CoII sequences from databases to confirm identity

For population genetic studies, sequencing multiple individuals (at least 20-30 per population) is recommended to capture genetic diversity adequately. Sanger sequencing is suitable for individual samples, while next-generation sequencing may be more efficient for large-scale studies.

How can the functional integrity of recombinant mt:CoII be verified?

Verifying the functional integrity of recombinant D. ambigua mt:CoII requires multiple approaches addressing both structural and functional aspects of the protein. Since mt:CoII functions as part of the larger cytochrome c oxidase complex, assessing its activity often requires incorporation into a suitable membrane environment.

Structural Verification:

  • SDS-PAGE and Western blotting: Confirm protein size and expression using antibodies against mt:CoII or attached tags

  • Circular dichroism (CD) spectroscopy: Assess secondary structure content

  • Limited proteolysis: Compare digestion patterns between recombinant and native proteins to verify similar folding

Functional Verification:

  • Cytochrome c oxidase activity assay: Measure the ability of the reconstituted complex to oxidize reduced cytochrome c

  • Oxygen consumption measurements: Quantify oxygen consumption rates using oxygen electrodes

  • Electron transfer kinetics: Assess the electron transfer properties using spectroscopic methods

Reconstitution Methods:

  • Proteoliposome incorporation: Reconstitute purified mt:CoII into liposomes with other complex IV components

  • Complementation assays: Test functional complementation in mt:CoII-deficient mitochondrial systems

A quantitative comparison between recombinant and native mt:CoII activities should be performed, with the native protein serving as a positive control. Additionally, known inhibitors of cytochrome c oxidase (e.g., cyanide, azide) can be used as negative controls to confirm that the observed activity is specific to the recombinant protein.

How should experiments be designed to study mt:CoII evolution across Drosophila species?

Designing experiments to study mt:CoII evolution across Drosophila species requires careful consideration of sampling strategies, analytical methods, and evolutionary models. A comprehensive experimental design should include the following elements:

Sampling Strategy:

  • Species selection: Include representatives from major Drosophila lineages, with particular focus on the obscura group

  • Population sampling: Sample multiple individuals from each species (at least 10-20) across their geographic range

  • Outgroup selection: Include appropriate outgroup species for rooting phylogenetic trees (D. ambigua can serve as an outgroup for studies focused on D. obscura)

Analytical Methods:

  • Sequence analysis:

    • Calculate nucleotide and haplotype diversity within species

    • Apply neutrality tests (Tajima's D, Fu's Fs, Fu and Li's D-F) to assess demographic history

    • Construct haplotype networks using methods like Median Joining Networks

  • Phylogenetic analyses:

    • Use both Maximum Likelihood and Bayesian inference methods

    • Apply appropriate evolutionary models based on model testing

    • Assess node support through bootstrap or posterior probability values

  • Tests for selection:

    • Calculate the ratio of non-synonymous to synonymous substitutions (dN/dS)

    • Perform McDonald-Kreitman tests to compare variation within and between species

    • Use site-specific and branch-specific models to detect positive selection

Table 1: Recommended Statistical Analyses for mt:CoII Evolution Studies

Analysis TypeSpecific TestsPurposeSoftware
Diversity MeasuresNucleotide diversity (π), Haplotype diversity (Hd)Quantify genetic variationDnaSP, MEGA
Neutrality TestsTajima's D, Fu's Fs, Fu and Li's D-F, Fay and Wu's HDetect departure from neutral evolutionDnaSP, Arlequin
Population StructureFST, AMOVA, PCAQuantify genetic differentiationArlequin, GENEPOP
Demographic HistoryMismatch distribution, Bayesian skyline plotsInfer population size changesDnaSP, BEAST
Selection TestsMcDonald-Kreitman test, dN/dS ratioDetect natural selectionDnaSP, PAML

The experimental design should also include controls to account for potential biases, such as sequencing errors or nuclear copies of mitochondrial genes (NUMTs). Additionally, comparing the evolutionary patterns of mt:CoII with other mitochondrial genes (e.g., Cyt b) and nuclear genes can provide a more comprehensive understanding of Drosophila evolution.

How can contradictory results in mt:CoII functional assays be interpreted and resolved?

Contradictory results in mt:CoII functional assays can arise from multiple sources, including technical variations, biological heterogeneity, or experimental design issues. Resolving these contradictions requires systematic troubleshooting and careful data analysis.

Common Sources of Contradictions:

  • Technical Variables:

    • Expression system differences affecting protein folding

    • Variations in reconstitution methods

    • Assay condition variations (temperature, pH, buffer composition)

    • Differences in protein purity or post-translational modifications

  • Biological Variables:

    • Nuclear genetic background effects on mitochondrial function

    • Heteroplasmy (mixed mitochondrial populations)

    • Compensatory mutations in other mitochondrial or nuclear genes

    • Environmental influences on mitochondrial function

Systematic Troubleshooting Approach:

  • Standardize experimental conditions:

    • Use identical protein preparation methods

    • Control temperature, pH, and buffer conditions precisely

    • Standardize substrate concentrations and reaction times

    • Include internal standards in each experiment

  • Cross-validation with multiple assays:

    • Employ multiple independent functional assays

    • Correlate functional data with structural information

    • Validate in vitro findings with in vivo experiments when possible

  • Statistical analysis:

    • Perform power analysis to ensure adequate sample size

    • Use appropriate statistical tests for data distribution

    • Consider Bayesian approaches for integrating prior knowledge

    • Meta-analysis of multiple experimental results

When contradictory results persist despite standardization efforts, they may reflect genuine biological complexity rather than experimental error. In such cases, designing experiments to specifically test alternative hypotheses can help resolve the contradiction. For example, if two different mt:CoII variants show opposite effects in different assays, creating chimeric constructs can help identify the specific regions responsible for the functional differences.

What statistical methods are most appropriate for analyzing mt:CoII sequence variation in population studies?

The choice of statistical methods for analyzing mt:CoII sequence variation depends on the specific research questions and the nature of the data. Based on approaches used in similar studies of mitochondrial genes in Drosophila, the following statistical framework is recommended:

Diversity and Demographic Analysis:

  • Basic diversity statistics:

    • Nucleotide diversity (π): Measures the average number of nucleotide differences per site between sequences

    • Haplotype diversity (Hd): Probability that two randomly chosen haplotypes are different

    • Number of segregating sites (S): Total number of variable positions

  • Tests for departure from neutrality:

    • Tajima's D: Compares the number of segregating sites to the average number of nucleotide differences

    • Fu's Fs: Evaluates the probability of observing a certain number of haplotypes

    • Fu and Li's D-F: Compares the number of mutations in internal vs. external branches

    • Fay and Wu's H: Detects selective sweeps using an outgroup comparison

  • Demographic history inference:

    • Mismatch distribution analysis: Compares observed and expected pairwise differences under population expansion models

    • Tests should be interpreted together, as they have different sensitivities to various demographic scenarios

Table 2: Interpretation of Neutrality Test Results

Test ResultTajima's DFu's FsFu and Li's D-FPotential Interpretation
Significant negative---Recent population expansion or purifying selection
Significant positive+++Population subdivision or balancing selection
Negative-NSNSMild recent expansion
Mixed signals-+NSComplex demographic history

NS = Not significant

Population Structure Analysis:

  • Fixation indices:

    • FST and related statistics to quantify population differentiation

    • Analysis of Molecular Variance (AMOVA) to partition genetic variation

  • Visualization methods:

    • Median Joining Networks to visualize relationships between haplotypes

    • Principal Component Analysis (PCA) or Multidimensional Scaling (MDS) to visualize population structure

What are the main challenges in expressing and purifying functional recombinant mt:CoII, and how can they be overcome?

Expressing and purifying functional recombinant mt:CoII presents several significant challenges due to its nature as a mitochondrially-encoded membrane protein. Understanding and addressing these challenges is critical for successful research applications.

Major Challenges and Solutions:

  • Protein misfolding and aggregation:

    • Challenge: Hydrophobic transmembrane domains tend to aggregate during expression

    • Solutions:

      • Use mild detergents (DDM, LDAO) during extraction and purification

      • Express as fusion with solubility-enhancing tags (MBP, SUMO)

      • Lower expression temperature (16-20°C) to slow folding

      • Consider cell-free expression systems with supplied chaperones

  • Codon usage bias:

    • Challenge: Mitochondrial genes use a different genetic code from nuclear genes

    • Solutions:

      • Optimize codons for the expression host

      • Use specialized expression vectors with rare tRNA supplements

      • Synthesize gene with optimized sequence rather than using native sequence

  • Loss of cofactors and interaction partners:

    • Challenge: mt:CoII functions as part of Complex IV with multiple cofactors

    • Solutions:

      • Co-express with other Complex IV subunits

      • Supplement purification buffers with required metal ions

      • Reconstitute with native lipids from Drosophila mitochondria

  • Post-translational modifications:

    • Challenge: Bacterial systems lack appropriate modification machinery

    • Solutions:

      • Use eukaryotic expression systems (insect cells, yeast)

      • Verify modifications by mass spectrometry

      • Engineer modifications chemically when possible

Purification Strategy:

A multi-step purification strategy typically yields the best results:

  • Affinity chromatography using tags (His, GST, FLAG)

  • Ion exchange chromatography to separate based on charge

  • Size exclusion chromatography as a final polishing step

Throughout purification, maintaining a stable detergent environment is critical. Incorporating functional assays at each purification step can help track activity recovery and identify conditions that maintain protein function.

How can recombinant D. ambigua mt:CoII contribute to understanding mitochondrial disease mechanisms?

Recombinant D. ambigua mt:CoII represents a valuable tool for understanding the molecular mechanisms underlying mitochondrial diseases. By serving as a model system, it can provide insights into fundamental aspects of mitochondrial function and dysfunction relevant to human health.

Mitochondrial diseases often result from mutations in genes encoding components of the electron transport chain, including cytochrome c oxidase. The relatively simple genetic system of Drosophila, combined with the conservation of basic mitochondrial functions, makes it an excellent model for studying disease-associated mutations. Research has shown that mutations in mitochondrial genes like mt:CoI in Drosophila can produce phenotypes ranging from mild to severe, including neurodegeneration, muscular atrophy, and reduced lifespan , paralleling the diversity of symptoms seen in human mitochondrial disorders.

Specific approaches for using recombinant D. ambigua mt:CoII in disease research include:

  • Modeling disease mutations:

    • Introduce mutations corresponding to those found in human patients

    • Assess functional consequences using in vitro and in vivo approaches

    • Test potential therapeutic interventions

  • Structure-function relationships:

    • Use site-directed mutagenesis to create a library of mutants

    • Map functional domains and critical residues

    • Correlate structural changes with functional outcomes

  • Drug screening platforms:

    • Develop high-throughput assays using recombinant protein

    • Screen compounds that may restore function to mutant proteins

    • Validate hits in cellular and organismal models

By providing a simplified system for studying mitochondrial protein function, recombinant D. ambigua mt:CoII can accelerate our understanding of disease mechanisms and potentially contribute to therapeutic development for mitochondrial disorders.

What emerging technologies will enhance research on recombinant mt:CoII?

Several emerging technologies promise to transform research on recombinant mt:CoII, enabling more sophisticated manipulation, analysis, and application of this protein in both basic and applied research contexts.

Genome Editing Technologies:

CRISPR-based approaches for mitochondrial genome editing are evolving rapidly, though they face unique challenges due to the different compartmentalization of the mitochondrial genome. Recent innovations such as mitochondria-targeted nucleases and base editors show promise for precise manipulation of mt:CoII in vivo. These technologies could enable the creation of specific mutations directly in the mitochondrial genome rather than relying on selection-based approaches like those described for mt:CoI .

Advanced Structural Biology Methods:

Cryo-electron microscopy (cryo-EM) is revolutionizing our ability to determine the structures of membrane protein complexes. Applied to cytochrome c oxidase containing recombinant mt:CoII, cryo-EM could reveal how sequence variations between species affect structure and how disease-associated mutations disrupt function. Combining cryo-EM with molecular dynamics simulations can provide insights into the dynamic behavior of mt:CoII within the complex.

Single-Molecule Techniques:

Single-molecule Förster resonance energy transfer (smFRET) and other single-molecule techniques allow researchers to observe the conformational changes and catalytic cycles of individual enzyme molecules. These approaches could reveal heterogeneity in mt:CoII function that might be masked in bulk assays and provide insights into the kinetic mechanisms of electron transfer.

Synthetic Biology Approaches:

Cell-free protein synthesis systems specifically designed for membrane proteins are improving rapidly. These systems could enable rapid production of mt:CoII variants without the complications of cellular expression. Furthermore, reconstitution of mt:CoII into synthetic membrane systems, such as nanodiscs or polymer-based membranes, offers new possibilities for functional and structural studies in defined environments.

As these technologies mature, they will provide researchers with unprecedented control over and insight into the structure, function, and evolution of mt:CoII, accelerating both basic science discoveries and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.