Recombinant Drosophila ananassae Spastin (spas)

Shipped with Ice Packs
In Stock

Description

Microtubule Regulation

  • Severing Activity: Spastin severs microtubules via ATP-dependent hydrolysis, generating dynamic fragments that influence cytoskeletal organization .

  • Stabilization: Paradoxically, Spastin loss in D. melanogaster reduces microtubule bundles at synapses, suggesting a role in stabilizing or nucleating microtubules .

Cellular Roles

  • Synaptic Morphology: In D. melanogaster, Spastin regulates neuromuscular junction (NMJ) growth and neurotransmission by modulating microtubule stability .

  • Lipid Droplet Dynamics: Spastin-M1 isoform influences lipid droplet size and triacylglycerol levels in fat bodies and neurons .

Applications in Research

Recombinant D. ananassae Spastin is used to:

  1. Investigate microtubule severing mechanisms in vitro.

  2. Study the impact of disease-associated mutations (e.g., ATPase-deficient variants like K388R) on enzymatic activity .

  3. Compare functional conservation across Drosophila species, given high sequence homology in the AAA domain .

Research Gaps and Opportunities

  • Species-Specific Studies: No peer-reviewed studies directly characterize D. ananassae Spastin’s biochemical or cellular functions. Existing data rely on homology with D. melanogaster.

  • Disease Modeling: Mutations in human SPAST cause hereditary spastic paraplegia (HSP). While D. melanogaster models HSP phenotypes , D. ananassae Spastin’s utility in disease modeling remains unexplored.

Future Directions

  • Structural Studies: Resolve the 3D structure to compare ATPase domains across species.

  • Functional Assays: Test severing efficiency and microtubule interaction kinetics using purified D. ananassae Spastin.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
spas; GF17034; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-770
Protein Length
full length protein
Species
Drosophila ananassae (Fruit fly)
Target Names
spas
Target Protein Sequence
MVRTKNQSSSSSASSSTKSPIKSGSAGSGSAAGGNSASGSRQSTHRSSSASNVASAAAAA VASSNRTRTSPGSSPDGDDDTTTTDDLTPTSCSPRSGHHHHGHPYGGSSVHKQNLYVVSF PIIFLFNVLRSLIYQLFCIFRYLYGASTKVIYRPHRRDCNIEIVVQNSKDQQQQHQSQPL SYPLELSEGGNPEQQLPSQTQRYRAIQPLEMASNRPGGGYSPGPGDPLLAKQKHHHRRAF EYISKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTN LSMARDRLHFLALREEDLRMQRLSLKEKQQKTLPQSDYKALKSREPMLAGMTNDPLKPRV RSSGYGPKASTSAQAAAATAASGRKLTIGTKRPGNLAVANKSQTLPRNLGSKTSVGAVQR QPAKTAATPPAVRRQFSSGRNTPPLRSRTPINNNGPSTSGSGASTPVVSVKGVEPKLVQL ILDEIVEGGAKVEWSDIAGQEVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNG KTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLL SERSSNEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYV SLPDEQTRELLLSRLLQKQGSPLDTEALRRLAKTTDGYSGSDLTALAKDAALEPIRELNV EQVKCLDISAMRAITESDFHSSLKRIRRSVAPQSLNSYEKWSQDYGDITI
Uniprot No.

Target Background

Function
ATP-dependent microtubule severing protein. Promotes microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Regulates microtubule stability within the neuromuscular junction synapse. Participates in lipid metabolism by influencing the size and distribution of lipid droplets. Plays a role in axon regeneration by controlling microtubule severing.
Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Chromosome. Lipid droplet.

Q&A

What is Drosophila ananassae Spastin and how does it compare to other Drosophila species?

Drosophila ananassae Spastin is a homolog of the AAA ATPase family protein that plays critical roles in microtubule dynamics, neuronal development, and lipid droplet regulation. While extensive research exists on D. melanogaster Spastin, direct studies on D. ananassae Spastin are more limited. The functional domains appear conserved across Drosophila species, with both containing the characteristic carboxyl-terminal AAA ATPase catalytic domain and the microtubule-interacting and trafficking (MIT) domain that enable microtubule binding and subsequent ATP hydrolysis-dependent severing of microtubule substrates . The high degree of conservation suggests functional similarity, though species-specific variations may exist.

What molecular mechanisms underlie Spastin function in Drosophila ananassae?

Spastin functions through a hexameric ring-shaped ATPase assembly that severs microtubules along their lengths, distinct from the dynamic instability mechanism that occurs at microtubule ends . Based on studies in D. melanogaster, Spastin monomers first bind to microtubule polymers through their MIT domain, promoting hexamerization of the protein. Subsequent ATP hydrolysis by the AAA domain generates the mechanical force needed to break the microtubule substrate . This activity regulates microtubule network architecture, particularly in neurons where proper microtubule dynamics are essential for synaptic function. In D. ananassae, these mechanisms are presumed to operate similarly, though species-specific variations in regulation or efficiency may exist.

What are the optimal expression systems for producing recombinant D. ananassae Spastin?

Based on experimental approaches with D. melanogaster Spastin, bacterial expression systems using E. coli (particularly BL21 derivatives) can be employed for producing recombinant D. ananassae Spastin fragments, though full-length protein may present solubility challenges due to its hydrophobic regions . For higher eukaryotic expression that preserves post-translational modifications, insect cell systems like Sf9 or High Five cells with baculovirus vectors have proven effective for AAA ATPases. When expressing D. ananassae Spastin, incorporating affinity tags (His6 or GST) at the N-terminus rather than C-terminus is recommended to avoid interfering with the critical C-terminal catalytic domain . Expression conditions should be optimized at lower temperatures (16-18°C) with reduced inducer concentrations to enhance proper folding of this complex protein.

What techniques are most effective for assessing D. ananassae Spastin microtubule-severing activity in vitro?

In vitro microtubule-severing assays for D. ananassae Spastin would follow methodologies established for D. melanogaster Spastin. These typically involve:

  • Purification of recombinant Spastin protein with preserved ATPase activity

  • Preparation of fluorescently labeled microtubules (typically using rhodamine-labeled tubulin)

  • Incubation of stabilized microtubules with purified Spastin in the presence of ATP

  • Real-time fluorescence microscopy to observe microtubule severing events

  • Quantification of severing activity by measuring decreases in microtubule length or increases in microtubule number over time

Control experiments should include ATP-γ-S (non-hydrolyzable ATP analog) or catalytically inactive Spastin mutants (such as the K467R mutation in D. ananassae, equivalent to K388R in D. melanogaster) to confirm ATP-dependency of the severing activity .

How can transgenic D. ananassae models be generated to study Spastin function?

Generating transgenic D. ananassae models to study Spastin function requires adaptation of techniques used in D. melanogaster. The methodology would include:

  • Cloning the D. ananassae spastin gene or creating desired mutations (e.g., equivalent to K388R in D. melanogaster)

  • Inserting the construct into appropriate vectors with tissue-specific or inducible promoters (GAL4-UAS system works effectively)

  • Embryonic microinjection of the construct along with a transposase source

  • Screening for successful transformants using phenotypic markers

  • Establishing stable transgenic lines through standard crossing schemes

For RNAi-mediated knockdown, designing species-specific RNAi constructs is critical, as D. ananassae sequence may differ sufficiently from D. melanogaster to affect RNAi efficiency. Given D. ananassae's unique male recombination characteristics, genetic mapping and crossing schemes may need adjustment compared to standard D. melanogaster protocols .

How can D. ananassae Spastin models contribute to understanding hereditary spastic paraplegia (HSP)?

D. ananassae Spastin models offer unique advantages for HSP research due to this species' distinct genetic characteristics, particularly its spontaneous male recombination at appreciable frequencies . This feature potentially allows more efficient genetic manipulation for disease modeling. To develop HSP models, researchers should:

  • Generate transgenic D. ananassae expressing human-equivalent mutations (particularly the catalytic domain mutations like K467R, corresponding to K388R in D. melanogaster or K388R in humans)

  • Create co-expression models with one wild-type and one mutant copy to mimic the autosomal dominant inheritance pattern of HSP

  • Implement behavioral assays, particularly climbing assays that measure negative geotactic response, which has been established as a reliable indicator of locomotor performance and correlates with HSP symptoms

  • Conduct histological analyses to detect vacuolization and TUNEL-positive cells in neural tissues, which indicate neurodegeneration

These models can be particularly valuable for testing potential therapeutic approaches, as demonstrated by the successful attenuation of HSP-like phenotypes using microtubule-targeting drugs like vinblastine in D. melanogaster models .

What are the comparative advantages of studying Spastin function across different Drosophila species?

Comparative studies of Spastin across different Drosophila species, particularly between D. melanogaster and D. ananassae, offer several research advantages:

The genomic resources available for multiple Drosophila species, including D. ananassae, facilitate these comparative approaches . When conducting such studies, researchers should account for species-specific differences in genetic background, development timing, and optimal laboratory conditions.

How can lipid droplet regulation by D. ananassae Spastin inform metabolic research?

Based on studies in D. melanogaster, Spastin plays an important role in lipid droplet (LD) regulation through microtubule remodeling. This function has significant implications for metabolic research. To investigate this in D. ananassae:

  • Generate tissue-specific Spastin knockdown or overexpression flies, particularly targeting fat body and oenocytes

  • Employ lipid staining techniques (Oil Red O, BODIPY, or Nile Red) to quantify changes in LD size, number, and distribution

  • Conduct lipidomic analyses to detect alterations in lipid composition

  • Measure metabolic parameters including triglyceride levels, glucose tolerance, and starvation resistance

  • Investigate potential interactions between Spastin and known lipid metabolism regulators

This research direction could reveal novel connections between cytoskeletal dynamics and metabolic regulation, potentially identifying new therapeutic targets for metabolic disorders. The contribution of D. ananassae studies would be particularly valuable if they reveal species-specific adaptations in this pathway that might correspond to ecological or evolutionary differences.

How can researchers resolve contradictory findings regarding dominant-negative versus haploinsufficiency mechanisms in Spastin mutations?

The literature presents contradictory evidence regarding whether Spastin mutations cause disease through dominant-negative effects or haploinsufficiency . To resolve these contradictions, researchers should:

  • Generate D. ananassae models with different types of mutations:

    • Catalytic domain mutations (like K467R) that potentially act through dominant-negative mechanisms

    • Truncation mutations that may act through haploinsufficiency

    • Modifier mutations like S44L/P45Q that exacerbate disease severity when in trans with catalytic domain mutations

  • Implement quantitative assays to measure:

    • Protein expression levels using western blotting with species-specific antibodies

    • Microtubule-severing activity in isolated neurons

    • Heteromeric vs. homomeric protein complex formation using co-immunoprecipitation

    • Subcellular localization of wild-type vs. mutant proteins

  • Conduct genetic interaction studies by systematically varying the ratios of wild-type to mutant Spastin

  • Apply statistical modeling approaches that can distinguish between competing mechanisms based on phenotypic severity across different genetic backgrounds

This systematic approach can help determine whether different mutations operate through distinct mechanisms or if the apparent contradictions reflect experimental or environmental variables .

What genomic and transcriptomic resources are available for D. ananassae Spastin research?

Researchers working with D. ananassae Spastin can utilize several genomic and transcriptomic resources:

  • The D. ananassae genome assembly, which provides the foundation for identifying and characterizing the spastin gene locus

  • Comparative genomic resources that include multiple Drosophila species, as shown in this table from the search results:

StrainAssembly size (bp)k-mer 1N50N90Number of contigs > 200 bpNumber of D. ananassae genes hit by contigs > 200 bpNumber of D. melanogaster genes hit by contigs > 200 bp 2
D.m. malerkotliana mal0-isoC552361339755273973167555750
D.m. malerkotliana mal0-sc22137616129:6362024842348101818696
D.m. pallens palQ121-isoA10340709356872651933999088195
D. bipectinata bip3-isoA2794440229:63106827641144105989125
D. merina9974770416322631940686187200
D. ercepeae7850500415682501557076916429
D.p. pseudoananassae Q117143464886345924034044110938803
D.p. nigrens VT04–33126421036344623930400106428458
  • Transcriptomic datasets that help identify expression patterns across tissues and developmental stages

  • Functional genomic tools including RNAi libraries and CRISPR/Cas9 constructs adapted for D. ananassae

When working with these resources, researchers should be aware that D. ananassae has fewer annotated genes with D. melanogaster orthologs identified, which may complicate comparative analyses . Developing species-specific molecular tools is often necessary for precise genetic manipulation in D. ananassae.

What statistical approaches are most appropriate for analyzing phenotypic data from D. ananassae Spastin studies?

When analyzing phenotypic data from D. ananassae Spastin studies, researchers should employ statistical approaches that account for the biological complexity of the system:

  • For survival analysis (lifespan studies):

    • Kaplan-Meier survival curves with log-rank tests for comparing different genotypes

    • Cox proportional hazards models to assess the impact of multiple variables and their interactions on survival

  • For behavioral assays (climbing/locomotor tests):

    • Repeated measures ANOVA to account for age-dependent changes in performance

    • Mixed-effects models that can handle both fixed effects (genotype, treatment) and random effects (individual variation, environmental factors)

  • For neurodegeneration quantification:

    • Blinded scoring systems with multiple independent observers

    • Image analysis algorithms for quantifying vacuolization or TUNEL-positive cells

    • Appropriate multiple testing corrections when examining multiple brain regions

  • For biochemical assays (protein expression, ATPase activity):

    • Normalization strategies that account for total protein or housekeeping gene expression

    • Non-parametric tests when data doesn't meet normality assumptions

    • Power analyses to ensure sufficient sample sizes for detecting biologically meaningful differences

Given D. ananassae's unique genetic characteristics, particularly its high rate of male recombination , genetic background effects may introduce additional variability that should be controlled for in experimental design and statistical analysis.

How might CRISPR/Cas9 gene editing advance D. ananassae Spastin research?

CRISPR/Cas9 gene editing offers transformative potential for D. ananassae Spastin research by enabling precise genomic modifications. Future applications include:

  • Creation of knock-in models that introduce human disease-causing mutations directly into the endogenous D. ananassae spastin locus, preserving natural expression patterns and avoiding overexpression artifacts

  • Generation of reporter lines with fluorescent tags inserted in-frame with endogenous spastin to monitor expression and localization without disrupting function

  • Systematic mutation of specific domains (MIT, AAA catalytic) to dissect their contributions to different Spastin functions

  • Introduction of conditional alleles (floxed genes with tissue-specific Cre expression) for spatiotemporal control of gene disruption

  • Implementation of base editing or prime editing technologies for introducing precise point mutations without double-strand breaks

Adapting CRISPR protocols for D. ananassae will require optimization of guide RNA design, delivery methods, and screening protocols. The unique characteristics of D. ananassae, including its male recombination patterns , may require adjustments to standard crossing schemes used for isolating edited lines.

What insights might proteomics approaches provide about D. ananassae Spastin interaction networks?

Comprehensive proteomics studies of D. ananassae Spastin would reveal crucial insights about its functional interaction networks:

  • Immunoprecipitation coupled with mass spectrometry (IP-MS) can identify direct binding partners of Spastin in different tissues and developmental stages

  • Proximity labeling techniques (BioID, APEX) can map the spatial neighborhood of Spastin at subcellular resolution, particularly at synapses and along microtubule networks

  • Quantitative proteomics comparing wild-type and spastin mutant tissues can reveal downstream effectors and compensatory responses

  • Phosphoproteomics can identify regulatory post-translational modifications on Spastin and detect changes in signaling networks

  • Cross-linking mass spectrometry (XL-MS) can provide structural insights into Spastin hexamer assembly and substrate interactions

These approaches would be particularly valuable for identifying species-specific interactors in D. ananassae versus those conserved from D. melanogaster, potentially revealing unique adaptations. Comparing interaction networks across species could illuminate evolutionary constraints on Spastin function and identify core pathways most relevant to human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.